ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2911

Name

GRM1

Synonym

GPRC1A|MGLU1|MGLUR1|PPP1R85|SCAR13;glutamate receptor, metabotropic 1;GRM1;glutamate receptor, metabotropic 1

Definition

metabotropic glutamate receptor 1|protein phosphatase 1, regulatory subunit 85

Position

6q24

Gene Type

protein-coding

Pathways and Diseases

Pathway

Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway;PANTHER;P00027

Pathway

Neuroactive ligand-receptor interaction;KEGG PATHWAY;hsa04080

Pathway

Gap junction;KEGG PATHWAY;hsa04540

Pathway

regulation of ck1/cdk5 by type 1 glutamate receptors;PID BioCarta;100201

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Long-term potentiation;KEGG PATHWAY;hsa04720

Pathway

Metabotropic glutamate receptor group III pathway;PANTHER;P00039

Pathway

Long-term depression;KEGG PATHWAY;hsa04730

Pathway

Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway;PANTHER;P00026

Pathway

Calcium signaling pathway;KEGG PATHWAY;hsa04020

Pathway

Huntington's disease;KEGG PATHWAY;hsa05016

Pathway

Metabotropic glutamate receptor group I pathway;PANTHER;P00041

External Links

Links to cell senescence gene database

2911

Links to epithelial mesenchymal transition gene database

2911

Links to ovarian cancer gene database

2911

Links to endometrial cancer gene database

2911

Links to iHOP

2911

Sequence Information

Nucleotide Sequence

>2911 : length: 6839
CAGGTACTCAGGTATGTCTCAAGTCCATGTCCTCCAAACAGACTCAGCATCTAGCTCACC
GCTGCCAACACGACTTCCACTGTACTCTTGATCAATTTACCTTGATGCACTACCGGTGAA
GAACGGGGACTCGAATTCCCTTACAAACGCCTCCAGCTTGTAGAGGCGGTCGTGGAGGAC
CCAGAGGAGGAGACGAAGGGGAAGGAGGCGGTGGTGGAGGAGGCAAAGGCCTTGGACGAC
CATTGTTGGCGAGGGGCACCACTCCGGGAGAGGCGGCGCTGGGCGTCTTGGGGGTGCGCG
CCGGGAGCCTGCAGCGGGACCAGCGTGGGAACGCGGCTGGCAGGCTGTGGACCTCGTCCT
CACCACCATGGTCGGGCTCCTTTTGTTTTTTTTCCCAGCGATCTTTTTGGAGGTGTCCCT
TCTCCCCAGAAGCCCCGGCAGGAAAGTGTTGCTGGCAGGAGCGTCGTCTCAGCGCTCGGT
GGCCAGAATGGACGGAGATGTCATCATTGGAGCCCTCTTCTCAGTCCATCACCAGCCTCC
GGCCGAGAAAGTGCCCGAGAGGAAGTGTGGGGAGATCAGGGAGCAGTATGGCATCCAGAG
GGTGGAGGCCATGTTCCACACGTTGGATAAGATCAACGCGGACCCGGTCCTCCTGCCCAA
CATCACCCTGGGCAGTGAGATCCGGGACTCCTGCTGGCACTCTTCCGTGGCTCTGGAACA
GAGCATTGAGTTCATTAGGGACTCTCTGATTTCCATTCGAGATGAGAAGGATGGGATCAA
CCGGTGTCTGCCTGACGGCCAGTCCCTCCCCCCAGGCAGGACTAAGAAGCCCATTGCGGG
AGTGATCGGTCCCGGCTCCAGCTCTGTAGCCATTCAAGTGCAGAACCTGCTCCAGCTCTT
CGACATCCCCCAGATCGCTTATTCAGCCACAAGCATCGACCTGAGTGACAAAACTTTGTA
CAAATACTTCCTGAGGGTTGTCCCTTCTGACACTTTGCAGGCAAGGGCCATGCTTGACAT
AGTCAAACGTTACAATTGGACCTATGTCTCTGCAGTCCACACGGAAGGGAATTATGGGGA
GAGCGGAATGGACGCTTTCAAAGAGCTGGCTGCCCAGGAAGGCCTCTGTATCGCCCATTC
TGACAAAATCTACAGCAACGCTGGGGAGAAGAGCTTTGACCGACTCTTGCGCAAACTCCG
AGAGAGGCTTCCCAAGGCTAGAGTGGTGGTCTGCTTCTGTGAAGGCATGACAGTGCGAGG
ACTCCTGAGCGCCATGCGGCGCCTTGGCGTCGTGGGCGAGTTCTCACTCATTGGAAGTGA
TGGATGGGCAGACAGAGATGAAGTCATTGAAGGTTATGAGGTGGAAGCCAACGGGGGAAT
CACGATAAAGCTGCAGTCTCCAGAGGTCAGGTCATTTGATGATTATTTCCTGAAACTGAG
GCTGGACACTAACACGAGGAATCCCTGGTTCCCTGAGTTCTGGCAACATCGGTTCCAGTG
CCGCCTTCCAGGACACCTTCTGGAAAATCCCAACTTTAAACGAATCTGCACAGGCAATGA
AAGCTTAGAAGAAAACTATGTCCAGGACAGTAAGATGGGGTTTGTCATCAATGCCATCTA
TGCCATGGCACATGGGCTGCAGAACATGCACCATGCCCTCTGCCCTGGCCACGTGGGCCT
CTGCGATGCCATGAAGCCCATCGACGGCAGCAAGCTGCTGGACTTCCTCATCAAGTCCTC
ATTCATTGGAGTATCTGGAGAGGAGGTGTGGTTTGATGAGAAAGGAGACGCTCCTGGAAG
GTATGATATCATGAATCTGCAGTACACTGAAGCTAATCGCTATGACTATGTGCACGTTGG
AACCTGGCATGAAGGAGTGCTGAACATTGATGATTACAAAATCCAGATGAACAAGAGTGG
AGTGGTGCGGTCTGTGTGCAGTGAGCCTTGCTTAAAGGGCCAGATTAAGGTTATACGGAA
AGGAGAAGTGAGCTGCTGCTGGATTTGCACGGCCTGCAAAGAGAATGAATATGTGCAAGA
TGAGTTCACCTGCAAAGCTTGTGACTTGGGATGGTGGCCCAATGCAGATCTAACAGGCTG
TGAGCCCATTCCTGTGCGCTATCTTGAGTGGAGCAACATCGAATCCATTATAGCCATCGC
CTTTTCATGCCTGGGAATCCTTGTTACCTTGTTTGTCACCCTAATCTTTGTACTGTACCG
GGACACACCAGTGGTCAAATCCTCCAGTCGGGAGCTCTGCTACATCATCCTAGCTGGCAT
CTTCCTTGGTTATGTGTGCCCATTCACTCTCATTGCCAAACCTACTACCACCTCCTGCTA
CCTCCAGCGCCTCTTGGTTGGCCTCTCCTCTGCGATGTGCTACTCTGCTTTAGTGACTAA
AACCAATCGTATTGCACGCATCCTGGCTGGCAGCAAGAAGAAGATCTGCACCCGGAAGCC
CAGGTTCATGAGTGCCTGGGCTCAGGTGATCATTGCCTCAATTCTGATTAGTGTGCAACT
AACCCTGGTGGTAACCCTGATCATCATGGAACCCCCTATGCCCATTCTGTCCTACCCAAG
TATCAAGGAAGTCTACCTTATCTGCAATACCAGCAACCTGGGTGTGGTGGCCCCTTTGGG
CTACAATGGACTCCTCATCATGAGCTGTACCTACTATGCCTTCAAGACCCGCAACGTGCC
CGCCAACTTCAACGAGGCCAAATATATCGCGTTCACCATGTACACCACCTGTATCATCTG
GCTAGCTTTTGTGCCCATTTACTTTGGGAGCAACTACAAGATCATCACAACTTGCTTTGC
AGTGAGTCTCAGTGTAACAGTGGCTCTGGGGTGCATGTTCACTCCCAAGATGTACATCAT
TATTGCCAAGCCTGAGAGGAATGTCCGCAGTGCCTTCACCACCTCTGATGTTGTCCGCAT
GCATGTTGGCGATGGCAAGCTGCCCTGCCGCTCCAACACTTTCCTCAACATCTTCCGAAG
AAAGAAGGCAGGGGCAGGGAATGCCAAGAAGAGGCAGCCAGAATTCTCGCCCACCAGCCA
ATGTCCGTCGGCACATGTGCAGCTTTGAAAACCCCCACACTGCAGTGAATGTTTCTAATG
GCAAGTCTGTGTCATGGTCTGAACCAGGTGGAGGACAGGTGCCCAAGGGACAGCATATGT
GGCACCGCCTCTCTGTGCACGTGAAGACCAATGAGACGGCCTGCAACCAAACAGCCGTCA
TCAAGCCCCTCACTAAAAGTTACCAAGGCTCTGGCAAGAGCCTGACCTTTTCAGATACCA
GCACCAAGACCCTTTACAACGTAGAGGAGGAGGAGGATGCCCAGCCGATTCGCTTTAGCC
CGCCTGGTAGCCCTTCCATGGTGGTGCACAGGCGCGTGCCAAGCGCGGCGACCACTCCGC
CTCTGCCGTCCCACCTGACCGCAGAGGAGACCCCCCTCTTCCTGGCCGAACCAGCCCTCC
CCAAGGGCTTGCCCCCTCCTCTCCAGCAGCAGCAGCAACCCCCTCCACAGCAGAAATCGC
TGATGGACCAGCTCCAGGGAGTGGTCAGCAACTTCAGTACCGCGATCCCGGATTTTCACG
CGGTGCTGGCAGGCCCCGGTGGTCCCGGGAACGGGCTGCGGTCCCTGTACCCGCCCCCGC
CACCTCCGCAGCACCTGCAGATGCTGCCGCTGCAGCTGAGCACCTTTGGGGAGGAGCTGG
TCTCCCCGCCCGCGGACGACGACGACGACAGCGAGAGGTTTAAGCTCCTCCAGGAGTACG
TGTATGAGCACGAGCGGGAAGGGAACACGGAAGAAGACGAACTGGAAGAGGAGGAGGAGG
ACCTGCAGGCGGCCAGCAAACTGACCCCGGATGATTCGCCTGCGCTGACGCCTCCGTCGC
CTTTCCGCGACTCGGTGGCCTCGGGCAGCTCGGTGCCCAGCTCCCCCGTGTCCGAGTCGG
TGCTCTGCACCCCTCCCAACGTATCCTACGCCTCTGTCATTCTGCGGGACTACAAGCAAA
GCTCTTCCACCCTGTAAGGGGGAAGGGTCCACATAGAAAAGCAAGACAAGCCAGAGATCT
CCCACACCTCCAGAGATGTGCAAACAGCTGGGAGGAAAAGCCTGGGAGTGGGGGGCCTCG
TCGGGAGGACAGGAGACCGCTGCTGCTGCTGCCGCTACTGCTGCTGCTGCCTTAAGTAGG
AAGAGAGGGAAGGACACCAAGCAAAAAATGTTCCAGGCCAGGATTCGGATTCTTGAATTA
CTCGAAGCCTTCTCTGGGAAGAAAGGGAATTCTGACAAAGCACAATTCCATATGGTATGT
AACTTTTATCACAAATCAAATAGTGACATCACAAACATAATGTCCTCTTTTGCACAATTG
TGCATAGATATATATATGCCCACACACACTGGGCCATGCTTGCCAAGGAACAGCCCACGT
GGACATGCCAGTCGGATCATGAGTTCACCTGATGGCATTCGGAGTGAGCTGGTGGAGCCA
GACAGAGCAGGTGCGGGGAAGGGAAGGGCCCAGGCCAGACCCATCCCAAACGGATGATGG
GATGATGGGACAGCAGCTCCTTGCTCAGAAGCCCTTCTCCCCGCTGGGCTGACAGACTCC
TCATCTTCAGGAGACTCAGGAATGGAGCGGCACAGGGGTCTCTCTTCATCCACTGCAACC
CATCCAGTGCCAGCTTTGAGATTGCACTTGAAGAAAGGTGCATGGACCCCCTGCTGCTCT
GCAGATTCCCTTTATTTAGGAAAACAGGAATAAGAGCAAAATTATCACCAAAAAGTGCTT
CATCAGGCGTGCTACAGGAGGAAGGAGCTAGAAATAGAACAATCCATCAGCATGAGACTT
TGAAAAAAAAACACATGATCAGCTTCTCATGTTCCATATTCACTTATTGGCGATTTGGGG
AAAAGGCCGGAACAAGAGATTGTTACGAGAGTGGCAGAAACCCTTTTGTAGATTGACTTG
TGTTTGTGCCAAGCGGGCTTTCCATTGACCTTCAGTTAAAGAACAAACCATGTGACAAAA
TTGTTACCTTCCACTTACTGTAGCAAATAATACCTACAAGTTGAACTTCTAAGATGCGTA
TATGTACAATTTGGTGCCATTATTTCTCCTACGTATTAGAGAAACAAATCCATCTTTGAA
TCTAATGGTGTACTCATAGCAACTATTACTGGTTTAAATGACAAATAATTCTATCCTATT
GTCACTGAAGTCCTTGTAACTAGCGAGTGAATGTGTTCCTGTGTCCTTGTATATGTGCGA
TCGTAAAATTTGTGCAATGTAATGTCAAATTGACTGGTCAATGTCAACCTAGTAGTCAAT
CTAACTGCAATTAGAAATTGTCTTTTGAATATACTATATATATTTTTTATGTTCCAATAA
TGTTTTGTACATCATTGTCATCAATATCTACAGAAGCTCTTTGACGGTTTGAATACTATG
GCTCAAGGTTTTCATATGCAGCTCGGATGGACATTTTTCTTCTAAGATGGAACTTATTTT
TCAGATATTTTCTGATGTGGAGATATGTTATTAATGAAGTGGTTTGAAAATTTGTTATAT
TAAAAGTGCACAAAAACTGAGAGTGAAAATAAAAGGTACATTTTATAAGCTTGCACACAT
TATTAACACATAAGATTGAACAAAGCATTTAGATTATTCCAGGTTATATCATTTTTTTAA
AGATTTTCCACAGCTACTTGAGTGTCTAACATACAGTAACATCTAACTCAGCTAATAATT
TGTAAAATCTTTATCAATCACATTTTGCCTTCTTTTAATTTTTATGTTCATGGACTTTTA
TTCCTGTGTCTTGGCTGTCATAACTTTTTATTTCTGCTATTTGCTGTTGTGTAATATCCA
TGGACATGTAATCCACTTACTCCATCTTTACAATCCCTTTTTACCACCAATAAAAGGATT
TTTCTTGCTGTTTTGATTTCTTCTATTATTTGTGGAATGAATTATACCCCCCTTAAATAT
CTTTGTTTATGCCTTATGTTCAGTCATATTTTAATATGCTTCCTTCATATTGAAGCTGCT
GATTTCTCAGCCAAAAATCATCTTAGAATCTTTAAATATCCATTGCATCATTTGTTCAGA
ATTTAACATCCATTCCAATGTTGGAGGCTTGTATTACTTATATTTCATCATATTCTATTG
CCAAGTTTAGTCAGTTCCACACCAAGAATGAACTGCATTTCCTTTAAAAATTATTTTAAA
ACACCTTTATTGAAAAGATCTCATGACTGAGATGTGGACTTTGGTTCCATGTTTTCATTG
TAAGAAAGCAGAGAGCGGAAAATCAATGGCTCCAGTGATTAATAGATGGGTTTTTAGTAA
TTGACAAATTCATGAGGGAAAGCATATGATCTCTTTATTAGTGAATCATGCTTATTTTTT
ACTCTTAATGCCACTAATATACATCCCTAATATCACAGGGCTTGTGCATTCAGATTTTTA
AAAAATTAGGATAGATAAGGAAACAACTTATATTCAAGTGTAAGATGATATCAGGTTGGT
CTAAGACTTTTGGTGAACACGTTCATTCAACTGTGATCACTTTATTACTCTGAATGCCTA
CTATTATCCTGATTATGGGGTCTCCTGAATAAATAGAGTATTAGTCCTTATGTCATCATT
GTTCAAAATTGGAGATGTACACATACATACCCTATACCAAGAGGGCCGAAACTCTTCACC
TTGATGTATGTTCTGATACAAGTTGTTCAGCTTCTTGTAAATGTGTTTTCCTTCGGCTTG
TTACTGCCTTTTGTCAAATAATCTTGACAATGCTGTATAATAAATATTTTCTATTTATT

Protein Sequence

>2911 : length: 1194
MVGLLLFFFPAIFLEVSLLPRSPGRKVLLAGASSQRSVARMDGDVIIGALFSVHHQPPAE
KVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSI
EFIRDSLISIRDEKDGINRCLPDGQSLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDI
PQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESG
MDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLL
SAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLD
TNTRNPWFPEFWQHRFQCRLPGHLLENPNFKRICTGNESLEENYVQDSKMGFVINAIYAM
AHGLQNMHHALCPGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYD
IMNLQYTEANRYDYVHVGTWHEGVLNIDDYKIQMNKSGVVRSVCSEPCLKGQIKVIRKGE
VSCCWICTACKENEYVQDEFTCKACDLGWWPNADLTGCEPIPVRYLEWSNIESIIAIAFS
CLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQ
RLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTL
VVTLIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPLGYNGLLIMSCTYYAFKTRNVPAN
FNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIA
KPERNVRSAFTTSDVVRMHVGDGKLPCRSNTFLNIFRRKKAGAGNANSNGKSVSWSEPGG
GQVPKGQHMWHRLSVHVKTNETACNQTAVIKPLTKSYQGSGKSLTFSDTSTKTLYNVEEE
EDAQPIRFSPPGSPSMVVHRRVPSAATTPPLPSHLTAEETPLFLAEPALPKGLPPPLQQQ
QQPPPQQKSLMDQLQGVVSNFSTAIPDFHAVLAGPGGPGNGLRSLYPPPPPPQHLQMLPL
QLSTFGEELVSPPADDDDDSERFKLLQEYVYEHEREGNTEEDELEEEEEDLQAASKLTPD
DSPALTPPSPFRDSVASGSSVPSSPVSESVLCTPPNVSYASVILRDYKQSSSTL