ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

28992

Name

MACROD1

Synonym

LRP16;MACRO domain containing 1;MACROD1;MACRO domain containing 1

Definition

MACRO domain-containing protein 1|O-acetyl-ADP-ribose deacetylase MACROD1|[Protein ADP-ribosylglutamate] hydrolase

Position

11q11

Gene Type

protein-coding

External Links

Links to cell senescence gene database

28992

Links to epithelial mesenchymal transition gene database

28992

Links to ovarian cancer gene database

28992

Links to endometrial cancer gene database

28992

Links to iHOP

28992

Sequence Information

Nucleotide Sequence

>28992 : length: 1445
CGCCTCCCGCTGGCTCCGAGCAGGTCGCCGCTGGCTGGCAGTCGCCACCCGGTCCCAGAG
TAAATAAGGGAGAGACACTCCCGAGCGCCGTAAATAGAGTCCAAGTGGGCGGAGAGCCGT
CCCGCGCCGCCCGCTCATGTCTCTACAGAGCCGACTGTCCGGCCGCCTGGCACAGCTGCG
CGCGGCGGGGCAGCTGCTCGTCCCCCCGCGCCCCCGGCCCGGACACTTGGCGGGTGCCAC
GAGGACCCGCAGCAGCACGTGCGGTCCCCCGGCGTTCCTGGGCGTGTTCGGCCGCCGTGC
GCGGACCTCGGCGGGAGTTGGGGCGTGGGGGGCGGCGGCGGTGGGGCGGACAGCCGGGGT
GCGCACTTGGGCCCCCCTGGCCATGGCGGCGAAGGTGGACCTGAGCACCTCCACCGACTG
GAAGGAGGCGAAATCCTTTCTGAAGGGCCTGAGTGACAAGCAGCGGGAGGAACATTACTT
CTGCAAGGACTTTGTCAGGCTGAAGAAGATCCCGACATGGAAGGAGATGGCGAAAGGGGT
GGCTGTGAAGGTGGAGGAGCCCAGGTATAAAAAGGACAAGCAGCTCAATGAGAAAATCTC
CCTGCTCCGCAGCGACATCACCAAGCTGGAGGTGGACGCCATCGTCAACGCCGGAGCCAA
GAGGCTGCGCATTAATGAGACCCGTGCTGCCGCGGCCCTCCTGGAATGTGATCCGGAGCC
TCAGGGAGGTTAATTTAGTGAGAGCCATGCAGCAGGCTTGGTTTCTTCTCTCAAGACTTC
ACACAAAGCCACTTTATGGCCAACGCTAAAGGTACCAGTCAATATGGATGGGATGGATTT
AGGGCGTGTTTTATGGATTCATAGCTGCTGTTTCCCTGGCACTGCACGAGGAGCACGCAT
TGCTGTCTGGCTCGGACCCAGGATTCGAAAGGAAAGCTTGTTGCTGGAAGGCCCAGGAGC
TCAAAAGGGGGGCGTCGCCAGAACCTGCGGGAACGAAGCTGTCAGTGCCATCACTGGCGA
GGAGTGGAGAGCAGGGAGCTTCATTGTCTGGTGTTAAAACAACATGTCCTGTTGTCACTC
GTACATTCTACAGACAGAAGAATGAGGTGTCAACAGAATCACTTTCTCATGTATTTACAG
AAATCTCTTTTCATCAGAGGTGCCTCCCTGGCCCTGGGTTCCGAGTTGTGTGGGAAATTG
TCCCACACCTTGCCCCTTTCTCAAATCATAAACTTTCAGCTATTCAAAAAAAAAAAAAGT
GGTCTGTTTTCTTGCACTTAAAGGAATGAGACAAATAAAAGGAGGGAGGAGTCACGTCTG
TACTCTGAGGGAATTGGCTGCAAGGTGTAATTTTGGATTTCACAAATGGAAAAATAGCAG
CATAGATTTTTCTTATATTATTTTACTGTTCATAGTGGTAAAAAATCAATTAAAGAGAAA
TTATC

Protein Sequence

>28992 : length: 334
MSLQSRLSGRLAQLRAAGQLLVPPRPRPGHLAGATRTRSSTCGPPAFLGVFGRRARTSAG
VGAWGAAAVGRTAGVRTWAPLAMAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFV
RLKKIPTWKEMAKGVAVKVEEPRYKKDKQLNEKISLLRSDITKLEVDAIVNAANSSLLGG
GGVDGCIHRAAGPLLTDECRTLQSCKTGKAKITGGYRLPAKYVIHTVGPIAYGEPSASQA
AELRSCYLSSLDLLLEHRLRSVAFPCISTGVFGYPCEAAAEIVLATLREWLEQHKDKVDR
LIICVFLEKDEDIYRSRLPHYFPVDPPSGPRSQL