ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

28951

Name

TRIB2

Synonym

C5FW|GS3955|TRB2;tribbles pseudokinase 2;TRIB2;tribbles pseudokinase 2

Definition

tribbles homolog 2

Position

2p24.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

28951

Links to epithelial mesenchymal transition gene database

28951

Links to ovarian cancer gene database

28951

Links to endometrial cancer gene database

28951

Links to iHOP

28951

Sequence Information

Nucleotide Sequence

>28951 : length: 4408
AGTCGCGGGGGCGGCGGGGGGGGGGCGGAGGCTCCGTGGAAATGTGTCGGTGACATTGAA
TGGGGAGACCGAGCGCGAGCGAGGCGCGCGCGCGCACACGCGCACTCACGGCCCCGCTCG
CTCCGAGATCCCCGGCCACGTAAGTAACTATTAATACCGCCTCGCCGGGGGATGCGGGCG
TGCTGAGCGCGGGGATTGGCCTCGGGCACCGTCGGCCGTCCCCTTTAATTTTTAAATACA
CGGTCCCCTCTTTTCTCTGGGGGGGGCAAGCAAGAAATCAAAGAAGGAGGAGACAAGCCG
TCAATTTTCTCCAAAACAAACCCCACCGGGCAATTTGGTCTCGGGGTAGGGGGAGACGGG
GTGATTGCAAATTATTCCAGGACGAGATCCAGTTCTCCAGCGGGAAAGGGGCAAAGGAAC
GCCGCGCGTTGGAAGGGCCAGGGACGCAGCTCCCCTTGCAGCGCCCGCAGGACCCCCGCA
AGCTCGTGCCGGCGAAATCGGAGACCGCCGATCTGTCCTCGTTCTCTCCTGCACGTCTGG
CTGCATTCGGAGGAAGACCTGGGGCGCGAGCGAGCGGCGACAGCATGAGCCTGTGCTGAC
CTCCGCGCGGCGGGCCGAGCCCAGGGCTTTGTCGCGGTACCTGCGCCCAGCCCGCGCCGC
AACTCTGTGCCCAGCTTTTGCAATCTTTTGTTGGCAGCGCTGACCGCACCAAGTTAAATG
CTCCCTTGCAATTTTTCTTTTTTTTGTTTGTTTGTTTAATTTTTGGAGAGCTCGCGATCT
TGGAAAAGCCTCAGACGCCATCTACAGTTAAAACGTAGGTAACTGCCCTCTCCCGCACCC
CCCCCTTACACGCCCCCCACCCTTTCCACCAAAAAAAGGGGGTGCAGCGCGGATTCTGGC
TGCCGTGCGTCGCCAGCCGGTAGACCCGTGCTTGTTTCCTTTCTCTTTTTGTTTGGCTTC
TAACGCGTTGGGACTGAGTCGCCGCCGTGAGCTCCCCGAAGACTGCACAAACTACCGCGG
GCTCCTCCGCCCCGTCTGCGATTCGGAAGCCGGCCTGGGGGTCGCGTCGGGAGCCCTGGC
GCTGCAGCTCCGCACCTTAGCAGCCCGGGTACTCATCCAGATCCACGCCGGGGACACACA
CACAGAGTAACTAAAAGTGCGGCGATTCTGCACATCGCCGACTGCTTTGGGGTAACAAAA
AGACCCGAGTTGCCTGCCGACCGAGGACCCCCGGGAGCCGGGCTCGGAGCAGACGAGGTA
TCCGGCGGCGCCCATTTGGGGGCTTCTAACTCTTTCTCCACGCAGCCCCTCTTCTGTCCC
CTCCCCTCTCGCTCCCTTTTAAAATCAGTGGCACCGAGGCGCCTGCAGCCGCACTCGCCA
GCGACTCATCTCTCCAGCGGGTTTTTTTTTGTTTGTCGTGTGCGATCCTCACACTCATGA
ACATACACAGGTCTACCCCCATCACAATAGCGAGATATGGGAGATCGCGGAACAAAACCC
AGGATTTCGAAGAGTTGTCGTCTATAAGGTCCGCGGAGCCCAGCCAGAGTTTCAGCCCGA
ACCTCGGCTCCCCGAGCCCGCCCGAGACTCCGAACTTGTCGCATTGCGTTTCTTGTATCG
GGAAATACTTATTGTTGGAACCTCTGGAGGGAGACCACGTTTTTCGTGCCGTGCATCTGC
ACAGCGGAGAGGAGCTGGTGTGCAAGGTGTTTGATATCAGCTGCTACCAGGAATCCCTGG
CACCGTGCTTTTGCCTGTCTGCTCATAGTAACATCAACCAAATCACTGAAATTATCCTGG
GTGAGACCAAAGCCTATGTGTTCTTTGAGCGAAGCTATGGGGACATGCATTCCTTCGTCC
GCACCTGCAAGAAGCTGAGAGAGGAGGAGGCAGCCAGACTGTTCTACCAGATTGCCTCGG
CAGTGGCCCACTGCCATGACGGGGGGCTGGTGCTGCGGGACCTCAAGCTGCGGAAATTCA
TCTTTAAGGACGAAGAGAGGACTCGGGTCAAGCTGGAAAGCCTGGAAGACGCCTACATTC
TGCGGGGAGATGATGATTCCCTCTCCGACAAGCATGGCTGCCCGGCTTACGTAAGCCCAG
AGATCTTGAACACCAGTGGCAGCTACTCGGGCAAAGCAGCCGACGTGTGGAGCCTGGGGG
TGATGCTGTACACCATGTTGGTGGGGCGGTACCCTTTCCATGACATTGAACCCAGCTCCC
TCTTCAGCAAGATCCGGCGTGGCCAGTTCAACATTCCAGAGACTCTGTCGCCCAAGGCCA
AGTGCCTCATCCGAAGCATTCTGCGTCGGGAGCCCTCAGAGCGGCTGACCTCGCAGGAAA
TTCTGGACCATCCTTGGTTTTCTACAGATTTTAGCGTCTCGAATTCAGCATATGGTGCTA
AGGAAGTGTCTGACCAGCTGGTGCCGGACGTCAACATGGAAGAGAACTTGGACCCTTTCT
TTAACTGAGCTCATGCCCCACGGAGACTTAGCAGGTTCCAGGAGTGAGCGAGGGCAGCGG
AAAGGAGTTCTTCCGGGGGACACGAATTGCCTGGCTGAGTAGCAAGAAAGACACACTCTT
AAGTTTCTTGGTTCAGAGCAGGAAAACCTTCAAGGAGCTGACTGACCACGTAGCATGGGG
GCAAGAGGCGTGGGATGGGGATTGGGGTGAGATGGATGGGAGCCCGCTGGAGCTTGTCTT
CCCTAACATAGCCTGGGAGACCACCCCTTGCCACTTGGGCCACTTCCGCCTACCCCACTT
TTCATTTTGTTCCAAAATAGTTGCAGATCCTGACAGAATCAAAACTCTCTGCCTCAAACA
CACATCCTGGCATCGCACTGTTAGCATTTAACTTCTTGTTAGGATTCAGGGAAGGAACAG
TTGGCCAAGAATTTTTTTTCTTTTAAACAAGCCAACCACCTAGCTGGTAATTAATGAGGT
TCACTTAAAAAAAAAATTCGGTGCACACAGACTGACATGAAACCTGGGTGCTACAGTAAA
AGAAAACAAAAGTCCAGTTTGTGTCTCTTAATCGCTCACTTCAACTCATTTCTTCTAAAT
AAACTATTTAATATCCTGGTCAGGAAATGACATGTTAATGCTTTGCTCCCTGAAGGGGGA
AAAAATCTGTCCTTTAACAAGCTATTCTGTTTTGTGTCAATTGGTTCGTGGCAGGAAGCT
ATTAGAAGTCAAACGTCCAGATGCATTACTGCTATCTTAGTTTAAAGGGGGAAAGAAAAG
GGAAGAAGAAAGGAAAAGAGAAATCCAACTCCTTTTTCATGTTTTGCTTTTGAACAATGA
GGGTTTGTGTGACAGGCATTCCTCTTTGCTGAGATGATAGCAATGGCCTGAGATTTTAGC
AAGCTCCTGGAGTCTGATGCTTTTGCAGTACTCTGATCGCAACTAAACATTTGTCTTTGT
TTTATTAGAAACTAGTGAAACAAAGCAGGTTGTCCCACATGTATAAAATACAGGGCAGCT
ATTTAGTTTTCTTTACAGAGAATGATCCTTTTAAGGCTTGTAAGGCCCTCTGGTTTGGAC
AAAAACCCTCAGTAGAGACAAGCGGGAAGGATAATTAGCTGAAAGCTATGATGATATAAA
TAAAAACAGCTCTCTATCCCAATACGCACCTTTGTATTTTCAAGAACTCTTCTATTTATT
AAGGAAAATGTCACATTGTGATGTATTAAGCCAGTACTTCAATTACGGGTTGACTTGGGA
TGACATATTACATGCTGTAGTTAACATTTATAATTCTTTTTCCTTGTTTGAGTATTTCTG
TCTCTGAAATAACCTTTTACTTGGCTTTTCTAGATAGCTTTATTTGATTTCGAGTGGCAA
AATGTTTTTTATTACGGCTTTTCTATTGCTGTATGATACAGAACTCTTTTGGCATAAATA
TTTGTGTTCCCAGTACCTCACTTGTTCGGATTTGACTGCCTGTATATGTTTTGTGAAATG
GTCCTGTTTTTGGGTAGGTGACACGTGGACTCTAGTATGTAAATGTTACTTGAATCTGTG
CTTCATAATAGTGTGTGGCATGTATGTGCAGACTCTTGGATGCTTTATGCCTGCGCAGCA
GGAGCCCTGTCCTCACGTTCCCAGGAGGGCGGCTTCACCCTTCGTAACCAGGAGACAAGG
CGGCCATGGATTTGCCCTTGATTCTATTTTGCTAATGGAAGATAGAAAGGAGAGAAGGTT
TTTTTTTTTTTTAACATTCTGAAGATGGTGCTGTGTCAAGAAGGACCTTTTTTTTCCCCT
CTCCCCTATTTTTTAAGTACCTTGGAGGAGGAGAGGTTGGTGACATGCATGGTGGGGATC
TATGGCCTCTGGTGCTTTGTCCTGTATTTGGTTTAATGTTTTTGTCCTAATCTCTTCAAT
CAATAAAATTGTGCGTATTTAACTAAAA

Protein Sequence

>28951 : length: 343
MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSC
IGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEII
LGETKAYVFFERSYGDMHSFVRTCKKLREEEAARLFYQIASAVAHCHDGGLVLRDLKLRK
FIFKDEERTRVKLESLEDAYILRGDDDSLSDKHGCPAYVSPEILNTSGSYSGKAADVWSL
GVMLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQ
EILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN