ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

283149

Name

BCL9L

Synonym

BCL9-2|DLNB11;B-cell CLL/lymphoma 9-like;BCL9L;B-cell CLL/lymphoma 9-like

Definition

B-cell CLL/lymphoma 9-like protein|B-cell lymphoma 9-like protein|BCL9-like protein|nuclear co-factor of beta-catenin signalling|protein BCL9-2

Position

11q23.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

283149

Links to epithelial mesenchymal transition gene database

283149

Links to ovarian cancer gene database

283149

Links to endometrial cancer gene database

283149

Links to iHOP

283149

Sequence Information

Nucleotide Sequence

>283149 : length: 7740
CGTGCGTGTCTTGTCTCCCTGTCCACGTGTGAGCTGTGAGTGTGTGTGAGTCAGAGTTCG
GGTGTCTGTGGGTCTCTGAGCCTCTGCTGGCAGCACCCGGGGCTCGCCAAGCTCTTGCCG
GCTGGCGCGCGCCCAGCCCCTGGCGGGACTTGTCCGTGTGTCTGTCCGCGCGCGGGGCCT
GGAGAAGCACGCTGCAGTCCTGTCCGCCTCCCGCTCGCTGCCTCGCTGGCTGTCGCTCGC
TCGCTCTGCCTCTCCGCCCGGGCTCTGCCGAAGGGGGCGGGGTGGGGGTGCAGGGCGGGG
GGAGGGGAGGCTCCTGCATTCTTGCGGTCGGGGAGGAATCCGAGCCAGCGTTACTGGTCT
CCAGAAGAGCCCAGCTGCAGCCCCGGGGCCCCGCCAGGCCTCTCGCTGCCCGCCCGGGCC
TGCTGGGATGGGCACGGGCTAGGCCTCGAGCTGGGGACGGGGCGGGGCGTGGCCCCAACC
CCGGGCCCCCTCCACGGCTGGAGCGCTCTGGGGGTGGGGCACGAGGGGTACCCCACCCTG
GGTGAGGGGCGCGTCTGGGAGCAGGAATCCCTCAGGGGGCCAGGGGAGACCTCACAGCCG
CCCCACACGGCACCTTTGCTACCTAGCCTTTTAGTGAATTCTGTCTCTGCCGCCCGTCGG
GGCGGAGGCTTGCTGGAGACTGCAAGCCCCCTGAGGGCAAGGTGCGGGAGGGATGGGGAC
AGGGCTGGCCTCCAGGATCGAGACCCCATCTCGTAATCCTCTTTTTCCAGTGCCACCCCA
CCCTATCCAGCTCCCTAGTCCCAGGGCTGTTGGGTCCTCCCTTCTCCCCTCCCCCTCTGA
CACCCCCTCCCCAAGTCACGAGTTTTCTCTTTGGGGCTTGTTGCTGCAGTCCGTGCTCCA
GTACCGAGTACCTGGCTGGGCCCTGGGCACGCACAGGGGCCGTAGCCCCACTGTGTGTGG
GAGCCATGAGGATCCTGGCTAACAAGACAAGGTTACCCCACCCCAGGAGGAGAGAAGCTC
CAGGGAGCCCGCCGCTGTCCCCCCGCGGTCATTGCCCCCCTGCCCCAGCCAAGCCAATGC
ACCCAGAAAATAAATTGACCAATCATGGCAAGACAGGGAATGGCGGGGCCCAATCTCAGC
ACCAGAATGTGAACCAAGGACCCACCTGCAACGTGGGCTCGAAGGGCGTGGGGGCGGGGA
ACCATGGGGCCAAGGCCAACCAGATCTCGCCTAGCAACTCAAGTCTGAAGAACCCCCAGG
CAGGGGTGCCCCCTTTCAGCTCGCTCAAGGGCAAGGTGAAGAGGGACCGGAGTGTGTCTG
TGGACTCTGGAGAGCAGCGAGAGGCTGGGACCCCATCCCTGGATTCAGAGGCCAAAGAGG
TGGCGCCGCGGAGTAAGCGGCGCTGTGTGCTGGAGCGGAAGCAGCCGTACAGTGGGGACG
AATGGTGCTCTGGACCGGACAGTGAGGAGGACGACAAGCCCATTGGGGCCACCCACAATT
GTAATGTAGCAGACCCAGCCATGGCGGCCCCACAGCTGGGTCCCGGCCAAACCACCCAAC
TGCCCCTCAGCGAGAGCAGCGTGCCAGGCGCCCCGCACGGCCCTCCTCCTGGCCTTCGGC
CTGATGCCCCTGGGGGCGGGGGCGGGGGCGGGGGCGTCCCCGGAAAGCCTCCCTCGCAGT
TCGTATATGTCTTCACCACCCACCTGGCCAACACGGCTGCAGAGGCAGTGCTGCAGGGCC
GGGCCGACTCCATCCTCGCCTACCACCAGCAGAACGTGCCCCGGGCCAAGCTTGACCAGG
CCCCTAAAGTGCCCCCCACCCCAGAACCGCTACCCCTGAGCACGCCGTCAGCAGGCACCC
CGCAGTCCCAGCCACCTCCACTGCCGCCGCCGCCACCCCCGGCCCCTGGCAGTGCCCCGC
CTGCTCTGCCCCCAGAGGGGCCTCCTGAGGACAGCAGTCAGGACCTGGCCCCCAACTCGG
TGGGAGCTGCCAGCACAGGTGGTGGGACTGGGGGCACCCACCCTAACACCCCGACGGCTA
CCACCGCCAACAACCCTCTGCCTCCTGGAGGAGACCCCAGCAGTGCCCCCGGCCCTGCCC
TGCTGGGGGAGGCAGCCGCCCCTGGAAATGGGCAGCGCAGCCTGGTGGGCTCAGAGGGCT
TGTCCAAAGAGCAGCTGGAGCATCGGGAACGGTCCCTCCAGACGCTGCGAGACATTGAGC
GACTGCTGCTCCGCAGCGGAGAGACTGAGCCCTTCCTCAAGGGGCCCCCAGGAGGAGCGG
GTGAGGGGGGCCCACCAGCACAAGCCCCCCCTCCCCCCCAGCAGCCACCCACGGCCCCTC
CCAGCGGGCTGAAGAAATATGAGGAACCCTTGCAGTCCATGATTTCACAGACACAGAGCC
TAGGGGGCCCCCCGCTGGAGCATGAAGTGCCTGGGCACCCCCCGGGTGGGGACATGGGGC
AGCAGATGAACATGATGATACAGAGGCTGGGCCAGGACAGCCTCACGCCTGAGCAGGTGG
CCTGGCGCAAGCTGCAGGAGGAGTACTACGAAGAGAAACGGCGGAAAGAGGAACAGATTG
GGCTGCATGGGAGCCGTCCTCTGCAGGACATGATGGGCATGGGGGGCATGATGGTGAGGG
GGCCCCCGCCTCCTTACCACAGCAAGCCTGGGGATCAGTGGCCACCTGGAATGGGTGCGC
AGCTGCGGGGGCCCATGGATGTTCAAGATCCCATGCAGCTCCGGGGCGGACCTCCCTTTC
CTGGGCCCCGTTTCCCAGGCAACCAGATACAACGGGTACCTGGGTTTGGGGGCATGCAGA
GTATGCCCATGGAGGTGCCCATGAATGCCATGCAGAGGCCCGTGAGACCAGGCATGGGCT
GGACCGAAGACTTGCCCCCTATGGGGGGACCCAGCAATTTTGCCCAGAACACCATGCCCT
ACCCAGGTGGGCAGGGTGAGGCGGAGCGATTCATGACTCCCCGGGTCCGTGAGGAGCTGC
TGCGGCACCAGCTGCTGGAGAAGCGGTCGATGGGCATGCAGCGCCCCCTGGGCATGGCAG
GCAGTGGCATGGGACAGAGCATGGAGATGGAGCGGATGATGCAGGCGCACCGACAGATGG
ATCCTGCCATGTTTCCCGGGCAGATGGCTGGTGGTGAGGGCCTGGCGGGCACTCCCATGG
GCATGGAGTTTGGTGGAGGCCGGGGCCTCCTGAGCCCTCCCATGGGGCAGTCTGGGCTGA
GGGAGGTGGACCCACCCATGGGGCCAGGCAACCTCAACATGAACATGAATGTCAACATGA
ACATGAACATGAACCTGAACGTGCAGATGACCCCGCAGCAGCAGATGCTGATGTCGCAGA
AGATGCGGGGCCCTGGGGACTTGATGGGGCCCCAGGGCCTCAGTCCTGAGGAGATGGCCC
GGGTTCGGGCCCAGAACAGCAGTGGCGTGATGGGCGGCCCGCAGAAGATGCTGATGCCTT
CACAGTTTCCCAACCAGGGCCAGCAGGGATTCTCTGGAGGCCAGGGACCCTACCAAGCCA
TGTCCCAGGACATGGGCAATACCCAAGACATGTTCAGCCCTGATCAGAGCTCAATGCCCA
TGAGCAACGTGGGCACCACCCGGCTCAGCCACATGCCTCTGCCCCCTGCGTCCAATCCTC
CTGGGACCGTGCATTCAGCCCCAAACCGGGGGCTAGGCAGGCGGCCTTCGGACCTCACCA
TCAGTATTAATCAGATGGGCTCACCGGGCATGGGGCACTTGAAGTCGCCCACCCTTAGCC
AGGTGCACTCACCCCTGGTCACCTCGCCCTCTGCCAACCTCAAGTCACCCCAGACTCCCT
CACAGATGGTGCCCTTGCCTTCTGCCAACCCGCCAGGACCTCTCAAGTCGCCCCAGGTCC
TCGGCTCCTCCCTCAGTGTCCGTTCACCCACTGGCTCGCCCAGCAGGCTCAAGTCTCCTT
CCATGGCGGTGCCTTCTCCAGGCTGGGTTGCCTCACCTAAGACGGCCATGCCCAGCCCGG
GGGTCTCCCAGAACAAGCAGCCGCCTCTCAACATGAACTCTTCCACCACCCTGAGCAACA
TGGAACAGGGTACCCTCCCGCCTAGCGGCCCCCGGAGCAGCTCCTCAGCACCTCCCGCCA
ACCCTCCCAGCGGCCTCATGAACCCCAGCCTACCATTCACTTCCTCCCCAGACCCCACAC
CTTCCCAGAACCCCCTGTCACTGATGATGACCCAGATGTCCAAGTACGCCATGCCCAGCT
CCACCCCGCTCTACCACAATGCCATCAAGACCATCGCCACCTCAGACGACGAGCTGCTGC
CCGACCGGCCCCTGCTGCCCCCCCCACCACCACCGCAGGGCTCCGGGCCAGGGATCAGCA
ACAGCCAGCCCAGCCAGATGCACCTGAACTCAGCCGCTGCCCAGAGCCCTATGGGCATGA
ACCTGCCAGGCCAGCAGCCCCTGTCCCATGAGCCCCCGCCCGCCATGCTGCCCTCCCCCA
CCCCTCTGGGCTCCAACATTCCACTGCATCCCAACGCACAGGGGACAGGGGGGCCCCCTC
AAAACTCCATGATGATGGCCCCAGGGGGCCCCGACTCCCTGAATGCCCCCTGTGGCCCAG
TGCCCAGCTCCTCCCAGATGATGCCCTTCCCCCCTCGGCTGCAGCAGCCCCATGGTGCCA
TGGCCCCCACTGGGGGTGGGGGCGGGGGGCCTGGCCTGCAGCAGCACTACCCGTCAGGCA
TGGCCCTGCCTCCCGAGGACCTGCCCAACCAGCCGCCAGGCCCCATGCCTCCCCAGCAGC
ACCTGATGGGCAAAGCCATGGCTGGGCGCATGGGCGACGCATACCCACCGGGTGTGCTCC
CTGGGGTGGCATCAGTGCTGAACGACCCCGAGCTGAGCGAGGTGATCCGGCCCACCCCAA
CGGGGATCCCCGAGTTCGACTTGTCGAGGATCATCCCCTCTGAGAAGCCAAGCAGCACCC
TCCAGTACTTCCCCAAGAGCGAGAACCAGCCCCCCAAGGCTCAGCCCCCTAATCTGCATC
TCATGAACCTGCAGAACATGATGGCGGAGCAGACTCCCTCTCGGCCTCCCAACCTCCCAG
GCCAGCAGGGCGTCCAGCGGGGGCTCAACATGTCCATGTGCCACCCTGGACAGATGTCCT
TGCTGGGCAGGACAGGCGTGCCCCCACAGCAGGGGATGGTGCCCCATGGCCTGCACCAGG
GGGTCATGTCCCCTCCACAAGGCCTCATGACCCAGCAGAATTTCATGCTGATGAAGCAGC
GGGGCGTGGGGGGCGAGGTCTACAGCCAGCCGCCCCACATGCTCTCCCCGCAGGGCTCCC
TCATGGGCCCCCCGCCCCAGCAGAACCTCATGGTGTCCCACCCCCTTCGGCAGCGCAGTG
TGTCCCTGGACAGCCAGATGGGCTACCTCCCGGCACCAGGCGGCATGGCCAACCTGCCCT
TCTAGAAGTCGCTGCCAGGGCTGGAGCCGGGGCAATGTTGCAAATACGATAACCTTAACA
AAGTTCTTCCCCTCAATGTTGGGATGGCCTGGGTCGCGGGGTGGGGTGGAGGGGGTGGGA
GGGGGCTTGTGTAGGGAGTGGCATTTGTGGAAACCAGATGTGCTGGCAGCTTAGGGGGAA
GTGGCAGTGTGGGGTGGGGGATTTTGCATTGGGGTTGGTTCCATTTCGGCCACCAGGACT
GCCCCTCCCCCACTCCTCCCAATTCCTATGGAGCCTCTCTATTTTACCTCTTTCCGTGCA
TCCCTGCACCCGCCACACCCCCTTCAGCTATGCTTTTGGAGTCCTGGATGGGAATCTGGG
GGGAGAGAGGAAGGACAGGTCAGGTCTCCCCCAGCCCCTTCTGCTCCTGTCTCCTCGTGT
CCGCATTGCTGGAGCTCCACCTCCCTCTTGGTTTCTCCGCACCCGCCCATTTTCCTTCTG
TCTTTACCTGCTTCGTATCCTTTCCCTGCTGATGTGGCTGACCCCTCTCCCACCCCTCCC
TGCAGGCGGCTGGCCAGGTGGGCAGGTGCCAGCCGGAGCTGTAAATAGAGCGCTGCGCTT
TTGTGCTGGTTTGTGCGTGTGCTGTATTTCTGTGTTTTGATAGAAGTCACACAAAAAAAA
AAGGATAAAAGAAACCCTTCCCCCCTTCTTCAAGTTATTGCTCCCTCCATTCCCCTGGAC
CCAGGGACATGCAGCCCTACATGGCCACCCACTGTTTGCAGTGTCTCTGGGTCCCTAAGG
GATACCATTCCTGTCTCGTCCCCAAATGGTAAGATGACGTAAATGACCCACTCCTAAACT
GAGGTCAGACCACCTAGGCTTCCACCTGGTGAGCCCTAGCAGGGCTGAGACCCCCAGGGC
GGCAGCCTGTCTGCTGCTGAGTGATTCAGGGAGAACATGTGTGCACGTGCATGTGTGTTT
GCCCACACCGGTGACACGGGGCCCTGGCTTTCCACTTTGGATGCCCGGGCATCCGCTGCT
GCTACATCTTAGCCAGAACTTGAAGTCTTTTGTCCCAGTTTGGGATGAAGGAAAGGAGGA
AGAGGCGGTGGCTGTGTGGCCCCCTTGAGTGGAGCCATGGAAGGGGTGGCATGGTGCCAC
TGGGGCCTGTGGCTGTAGTAGCCCTGGGCCAGGTAACCTCCAGGGCCCTGACTTTTCCAG
AGGCTGCTGCCACCTACTTCTTATCAAAGAAGGGGGAGAACAGTTCATCTGAGTCAGTGC
ACCTCCCCTCCAGTCTCCACTCCCTGAGGATGGAATCGGGGAAACAGCATCCTGCCGCCT
CCTCTCTGCCTGCCCACTCACCGGCAAGGTTGTCCCTCTGCCCAGGGCTCAGGGCCATGT
ACCAGATCTGTCTGTGCCCACCCAGGCACAGCCACTGCCTCCCCCTTGGCTCCCTGCTCC
TACCCAGGAGAGCTCCCTATCCGCCTTTGGTCAGAGCTGAAGCCATATACGACTGGGTGT
TTGTCCCCCTACTTTGGCCCCAGGAGTAAAAAAACTTCTCCTTTTCTCACTTCCTTTCCT
GCCTCGGGAGGTGGCAGGGCAGTTCCCTGGCTGAGGCCTTTTGCGCCCCACCTCCAGGAC
CAAGGGCCATTCTAGACAGGGTGTCTTCTACCAGGACCCGTCCCTAGCCTTCCTGGCCTG
GAGGGCCTGGTCTTGCACTGGCAGCTGTAATACAAAGGGAACTCGCCCCACTTCTCCCAG
CCTGGTGCTGTCCTCTCGGCCCACCATCGGCCAGGTCCAGCGCTTCCTCTGGGGCTGACA
ACAGGCCCCTGACTCACCCCGGTCACCTCCCAGGGTCCATGGCCAGGGCCTCTGTGTTTG
GGGGGCCACTTGCCCTTCATCCTGCCAGGCGCTTTGCCCGCCCTGCCTCAGCCTGGGCCC
TGTGCCCTTGAGCCCTCCACCCCTGGCCCAAGACCCCCCCAAACTGTCTGACTCTGTGTT
TCCTGCCCTGAGGAGAGAGGGGTCAGATTGCAGCGGGCCGAGTGCCCTCTCCGTCCCCTC
TCCTCCCACCCACGCCACAGGCCAGCCTACTCTTCCCTCCATCCATGGCCACACCCCCAG
CCATTTTGTACCATTATATAAATATATATATAAATATAAATATATAAATACAATATGTGA
AGACATCTTCTTGGTTTTTATTTTGAAACAATTTTTAGGCTTGTTCCGGGGGTCTCTGTG
CTGCCTGTACTGTATTGACCTGTTTTATAGGTGCCTTTTTATTAAAAAGAAAATTCAAAA

Protein Sequence

>283149 : length: 1514
MLKSDTEDRVATEACRLMGVLGLRLPHPRRREAPGSPPLSPRGHCPPAPAKPMHPENKLT
NHGKTGNGGAQSQHQNVNQGPTCNVGSKGVGAGNHGAKANQISPSNSSLKNPQAGVPPFS
SLKGKVKRDRSVSVDSGEQREAGTPSLDSEAKEVAPRSKRRCVLERKQPYSGDEWCSGPD
SEEDDKPIGATHNCNVADPAMAAPQLGPGQTTQLPLSESSVPGAPHGPPPGLRPDAPGGG
GGGGGVPGKPPSQFVYVFTTHLANTAAEAVLQGRADSILAYHQQNVPRAKLDQAPKVPPT
PEPLPLSTPSAGTPQSQPPPLPPPPPPAPGSAPPALPPEGPPEDSSQDLAPNSVGAASTG
GGTGGTHPNTPTATTANNPLPPGGDPSSAPGPALLGEAAAPGNGQRSLVGSEGLSKEQLE
HRERSLQTLRDIERLLLRSGETEPFLKGPPGGAGEGGPPAQAPPPPQQPPTAPPSGLKKY
EEPLQSMISQTQSLGGPPLEHEVPGHPPGGDMGQQMNMMIQRLGQDSLTPEQVAWRKLQE
EYYEEKRRKEEQIGLHGSRPLQDMMGMGGMMVRGPPPPYHSKPGDQWPPGMGAQLRGPMD
VQDPMQLRGGPPFPGPRFPGNQIQRVPGFGGMQSMPMEVPMNAMQRPVRPGMGWTEDLPP
MGGPSNFAQNTMPYPGGQGEAERFMTPRVREELLRHQLLEKRSMGMQRPLGMAGSGMGQS
MEMERMMQAHRQMDPAMFPGQMAGGEGLAGTPMGMEFGGGRGLLSPPMGQSGLREVDPPM
GPGNLNMNMNVNMNMNMNLNVQMTPQQQMLMSQKMRGPGDLMGPQGLSPEEMARVRAQNS
SGVMGGPQKMLMPSQFPNQGQQGFSGGQGPYQAMSQDMGNTQDMFSPDQSSMPMSNVGTT
RLSHMPLPPASNPPGTVHSAPNRGLGRRPSDLTISINQMGSPGMGHLKSPTLSQVHSPLV
TSPSANLKSPQTPSQMVPLPSANPPGPLKSPQVLGSSLSVRSPTGSPSRLKSPSMAVPSP
GWVASPKTAMPSPGVSQNKQPPLNMNSSTTLSNMEQGTLPPSGPRSSSSAPPANPPSGLM
NPSLPFTSSPDPTPSQNPLSLMMTQMSKYAMPSSTPLYHNAIKTIATSDDELLPDRPLLP
PPPPPQGSGPGISNSQPSQMHLNSAAAQSPMGMNLPGQQPLSHEPPPAMLPSPTPLGSNI
PLHPNAQGTGGPPQNSMMMAPGGPDSLNAPCGPVPSSSQMMPFPPRLQQPHGAMAPTGGG
GGGPGLQQHYPSGMALPPEDLPNQPPGPMPPQQHLMGKAMAGRMGDAYPPGVLPGVASVL
NDPELSEVIRPTPTGIPEFDLSRIIPSEKPSSTLQYFPKSENQPPKAQPPNLHLMNLQNM
MAEQTPSRPPNLPGQQGVQRGLNMSMCHPGQMSLLGRTGVPPQQGMVPHGLHQGVMSPPQ
GLMTQQNFMLMKQRGVGGEVYSQPPHMLSPQGSLMGPPPQQNLMVSHPLRQRSVSLDSQM
GYLPAPGGMANLPF