ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2824

Name

GPM6B

Synonym

M6B;glycoprotein M6B;GPM6B;glycoprotein M6B

Definition

neuronal membrane glycoprotein M6-b|protolipid M6B

Position

Xp22.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

2824

Links to epithelial mesenchymal transition gene database

2824

Links to ovarian cancer gene database

2824

Links to endometrial cancer gene database

2824

Links to iHOP

2824

Sequence Information

Nucleotide Sequence

>2824 : length: 3219
ACTGTAGGCACCACCGGGCGCCGAATGGCTGTTTTCTAACTGGGATCCTCGGTGACGTAT
GGCTGCCTGCCCCTTGGCAGCTGTCTTTATGGACCAGTAGGCAGAGCGAAATTGACGCTG
ACAAGACTTTTGCATCTTGGAAGGGACTGTAATCTACTGTAGTGAAGAACAGAGCCTCTC
AATCAGACGGGTGTAAATAAGAGACGGAGGGGAGTCCAAAAGAAAAGGAAGAGGAGGAAA
AACAAGTGTGTGTTGGGGGGAACAGGGGGAAAAGCATTTTTGGTGGATGGTATGAAGCCA
GCCATGGAAACTGCAGCCGAGGAAAATACTGAACAAAGCCAAGAGAGAAAAGTGAACAGC
AGAGCTGAAATGGAAATTGGCAGGTACCACTGGATGTACCCAGGCTCAAAGAACCACCAG
TACCATCCCGTGCCAACCCTGGGGGACAGGGCTAGCCCCTTGAGCAGTCCAGGCTGCTTT
GAATGCTGCATCAAGTGTCTGGGAGGAGTCCCCTACGCCTCCCTGGTGGCCACCATCCTC
TGCTTCTCCGGGGTGGCCTTATTCTGCGGCTGTGGGCATGTGGCTCTCGCAGGCACCGTG
GCGATTCTTGAGCAACACTTCTCCACCAACGCCAGTGACCATGCCTTGCTGAGCGAGGTG
ATACAACTGATGCAGTATGTCATCTATGGAATTGCGTCCTTTTTCTTCTTGTATGGGATC
ATTCTGTTGGCAGAAGGCTTTTACACCACAAGTGCAGTGAAAGAACTGCACGGTGAGTTT
AAAACAACCGCTTGTGGCCGATGCATCAGTGGAATGTTCGTTTTCCTCACCTATGTGCTT
GGAGTGGCCTGGCTGGGTGTGTTTGGTTTCTCAGCGGTGCCCGTGTTTATGTTCTACAAC
ATATGGTCAACTTGTGAAGTCATCAAGTCACCGCAGACCAACGGGACCACGGGTGTGGAG
CAGATCTGTGTGGATATCCGACAATACGGTATCATTCCTTGGAATGCTTTCCCCGGAAAA
ATATGTGGCTCTGCCCTGGAGAACATCTGCAACACAAACGAGTTCTACATGTCCTATCAC
CTGTTCATTGTGGCCTGTGCAGGAGCTGGTGCCACCGTCATTGCCCTGATCCACTTCCTC
ATGATACTGTCTTCTAACTGGGCTTACTTAAAGGATGCGAGCAAAATGCAGGCTTACCAG
GATATCAAAGCAAAGGAAGAACAGGAACTGCAAGATATCCAGTCTCGGTCAAAAGAACAA
CTCAATTCTTACACATAAATGTTTGCCAGAGTGTTTCGGCCGACGTATTTACAGCTCTGA
CAAATCATCAGACAGCTGCTCTGCAGTACAGATGTGTATCCCACCAAACTAATGTAGATG
TACAAACACTTCACTGTCTGTCTCAAGCTGCTGGGATGTATCTCTAGGAAAACCTTCCAG
TGGGTAAATCTTTTTCTTTAGAACAAATATTGGAGGTTTCATGTTAGCCATTTTAAAAGG
CAACACTTTGACAAAATGATCGTTCATACTTTGGGAATTTGTGGCATGTTCACATTTATT
GCTAGGGCAATTCTACCAAGACACTCAATGGAATATGTCACACTCCTTAATAGGGACCTG
TGACTCCTTAATAAGGACCTGTGACATGCCCAGCATCAAGGGATAAGACCGTAAATTCAC
ATATATGCCATCTGTCCTCAAGTGTTATCTACATAGGAAATAAAATGGAATTGATGTAAA
GTTCCATTTCTGACAGCTGACATTTATTAAACTTTGGATCAAAGATAATGTGATTCTTAT
GATTGATTTCTCAAACTAGCTTTTCCCTCCCAAGTCCAGGACCCATTAATTTCCTGAGCC
AATCAGAAATATATTTTTCAATAATGCTAAAATTAGCTACAATTCTGCTGACCCTACTAT
TAAAGAATCTGGATGCTGGACTCACTGACAAGCTTTCCAGAAGCAATTTTATAACAGATT
TCATTTTAACAAAATACTGATCCAATTTTCATTATTCTTGAGAAATGTCAGCTTTGCCTT
AATGAGTATTTGCTTTAAATTTCTAAGAATTTATATCATAACTAGAGACCCAAATATCTT
TCACAGAATTTTGTTCCATAAATGTTTTTCTTAATTATTAAGAAGTGTTACCTTATTAAA
ATGACCACCATTCTAAACCATTTTTCAGTGGTCTGGATACGAAGTTTACAGTTTCATACC
AACTATCTAAAACCTAATTGCAAATTGACCACAGACCTCTAACCTCCTACTTTTATAGAC
TTGAATACTTAAGTAATTTAAATTAGGGTTGGTATTTCATTTTTTTCTTATCTAAATCTT
AGTTTCCTGGAATAATAAAGTTTGATGTTCAGCAAGAGAACTGCTTGAGTTTAAGCCATT
TTCAAAAGAAACTTGCCTTTTACATTATTGTGTTCCAGAACATTAAGTGACTGTAGGTAC
TGGGTATTAGTGATGGTAAACTTTGTGTTGCTCTTTATGAAATGATCCATATAACTGTTG
GGTGCATCAGTGCTTTTCAAAGGGGCTGCTTACTATAGGGTTAACTATGTATATTCATTG
TTAAGAGTTAACTTGTGGTTTGGCTGTTTCCTGGATTTTATAACATACATGTGCAGAAAT
GTATTCAAATGAAAGGAAGCATACCTTTATCAAGATGCTATTAAAATTGAACATCAAGTA
TAATATTTCATTTGGATTCTCTTTTTTGGTTAATGCCTAAAAATGCCTATTTGGGATTTT
TTTTTTTTTTTAAATTAAGAGAAGCTCTCTTCTGTGTAGAACAGTTGTTCCAAAATAGCT
TAGTGTTTTGTTTTCCTGTTGCATGACAGATTTAACTATTCTTTCCAGCAGTGGAGGTGC
TGTCAGAGTCCAGTGTTCTAGAAGAGGCAGTGTCTAAAGCCTAATTTTACTTTTCTAATT
CTGGTAGCTATTACCAGGAATTTTTGAAAGTTTTGTTTAAGTAGTCTAATATTTTTTATG
TAAAGAGCATTAAATTTTGCTATGTATAAATTTTTGTAACCTAACAGTGAATCAATATTT
TCTATCAGTGCCAAGGGCTTCCTGTAGTTCTATTCAAGTGTTACAATAAATATTTGTAGA
TAATAGTCAATACTTGTGTATGCTTATTTTAAAGATCTATTTAGGTGGAAATAGTTGTGG
ATGTACTAAGAGTAATGAAATAAAATTATAGCTTCAAAA

Protein Sequence

>2824 : length: 328
MKPAMETAAEENTEQSQERKVNSRAEMEIGRYHWMYPGSKNHQYHPVPTLGDRASPLSSP
GCFECCIKCLGGVPYASLVATILCFSGVALFCGCGHVALAGTVAILEQHFSTNASDHALL
SEVIQLMQYVIYGIASFFFLYGIILLAEGFYTTSAVKELHGEFKTTACGRCISGMFVFLT
YVLGVAWLGVFGFSAVPVFMFYNIWSTCEVIKSPQTNGTTGVEQICVDIRQYGIIPWNAF
PGKICGSALENICNTNEFYMSYHLFIVACAGAGATVIALIHFLMILSSNWAYLKDASKMQ
AYQDIKAKEEQELQDIQSRSKEQLNSYT