ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2778

Name

GNAS

Synonym

AHO|C20orf45|GNAS1|GPSA|GSA|GSP|NESP|PHP1A|PHP1B|PHP1C|POH|SgVI;GNAS complex locus;GNAS;GNAS complex locus

Definition

adenylate cyclase-stimulating G alpha protein|alternative gene product encoded by XL-exon|extra large alphas protein|guanine nucleotide binding protein (G protein), alpha stimulating activity polypeptide 1|guanine nucleotide regulatory protein|guanine nuc

Position

20q13.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Vascular smooth muscle contraction;KEGG PATHWAY;hsa04270

Pathway

role of beta-arrestins in the activation and targeting of map kinases;PID BioCarta;100229

Pathway

Vibrio cholerae infection;KEGG PATHWAY;hsa05110

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

signaling pathway from g-protein families;PID BioCarta;100153

Pathway

phospholipase c-epsilon pathway;PID BioCarta;100070

Pathway

ion channels and their functional role in vascular endothelium;PID BioCarta;100055

Pathway

Transmembrane transport of small molecules;Reactome;REACT:15518

Pathway

Salivary secretion;KEGG PATHWAY;hsa04970

Pathway

Vasopressin-regulated water reabsorption;KEGG PATHWAY;hsa04962

Pathway

Amoebiasis;KEGG PATHWAY;hsa05146

Pathway

Melanogenesis;KEGG PATHWAY;hsa04916

Pathway

Glucagon signaling in metabolic regulation;PID Reactome;500715

Pathway

Regulation of Insulin Secretion by Glucagon-like Peptide-1;PID Reactome;500139

Pathway

gata3 participate in activating the th2 cytokine genes expression;PID BioCarta;100157

Pathway

beta-arrestins in gpcr desensitization;PID BioCarta;100231

Pathway

corticosteroids and cardioprotection;PID BioCarta;100156

Pathway

LPA4-mediated signaling events;PID Curated;200036

Pathway

Diabetes pathways;Reactome;REACT:15380

Pathway

roles of beta arrestin dependent recruitment of src kinases in gpcr signaling;PID BioCarta;100230

Pathway

Taste transduction;KEGG PATHWAY;hsa04742

Pathway

activation of camp-dependent protein kinase pka;PID BioCarta;100151

Pathway

activation of csk by camp-dependent protein kinase inhibits signaling through the t cell receptor;PID BioCarta;100196

Pathway

how progesterone initiates the oocyte maturation;PID BioCarta;100104

Pathway

Calcium signaling pathway;KEGG PATHWAY;hsa04020

Pathway

GnRH signaling pathway;KEGG PATHWAY;hsa04912

Pathway

transcription factor creb and its extracellular signals;PID BioCarta;100198

Pathway

Chagas disease;KEGG PATHWAY;hsa05142

Pathway

Pancreatic secretion;KEGG PATHWAY;hsa04972

Pathway

Gap junction;KEGG PATHWAY;hsa04540

Pathway

Hemostasis;Reactome;REACT:604

Pathway

ccr3 signaling in eosinophils;PID BioCarta;100215

Pathway

Integration of energy metabolism;Reactome;REACT:1505

Pathway

chrebp regulation by carbohydrates and camp;PID BioCarta;100203

Pathway

regulation of spermatogenesis by crem;PID BioCarta;100197

Pathway

attenuation of gpcr signaling;PID BioCarta;100253

Pathway

Dilated cardiomyopathy;KEGG PATHWAY;hsa05414

Pathway

Long-term depression;KEGG PATHWAY;hsa04730

Pathway

regulation of ck1/cdk5 by type 1 glutamate receptors;PID BioCarta;100201

Pathway

G alpha (s) signalling events;PID Reactome;500433

Pathway

Gastric acid secretion;KEGG PATHWAY;hsa04971

Pathway

cystic fibrosis transmembrane conductance regulator (cftr) and beta 2 adrenergic receptor (b2ar) pathway;PID BioCarta;100205

Disease

Osseous heteroplasia, progressive;OMIM

Disease

Pseudohypoparathyroidism Ic;OMIM

Disease

Prolonged bleeding time, brachydactyly and mental retardation;OMIM

Disease

PSYCH;GAD

Disease

Acromegaly;OMIM

Disease

leukemia;GAD

Disease

Pseudohypoparathyroidism Ia;OMIM

Disease

breast cancer;GAD

Disease

liver cancer;GAD

Disease

CARDIOVASCULAR;GAD

Disease

schizophrenia;GAD

Disease

kidney cancer;GAD

Disease

CANCER;GAD

Disease

hypertension;GAD

Disease

NEUROLOGICAL;GAD

Disease

autonomic nervous system dysfunction;GAD

Disease

Pseudohypoparathyroidism Ib;OMIM

Disease

bladder cancer;GAD

Disease

esophageal cancer;GAD

Disease

McCune-Albright syndrome;OMIM

Disease

migraine migraine with aura;GAD

External Links

Links to cell senescence gene database

2778

Links to epithelial mesenchymal transition gene database

2778

Links to ovarian cancer gene database

2778

Links to endometrial cancer gene database

2778

Links to iHOP

2778

Sequence Information

Nucleotide Sequence

>2778 : length: 3784
AGGATAGACCAAGGAAGAGGGGCTGGGGGGCAGCCTGGGGGCATGAAAAGTGGCCAGGAA
GGAGCCAAGACTCCACCAGCAACAATTGAGTTGCTTCAGCCTCAGTCTAGGGTTCCTTCC
AGGCCTTGAACCCCCCAACCTCACAAGGGTTGGAAAGTGAGGCCGGTGAACTTTCCAGCT
GGTACTTTGATTTTAAAATAATAATAATAATTTTTTCACCCTAGTTCGGTTGGGTGCTCC
ATCTTACGGAGCCCCAAACTTATTTTGAGAGGCCGCCACCGTGTTATGGGCGTGCGCAAC
TGCCTCTACGGCAATAATATGTCAGGACAACGCGATATCCCCCCTGAAATCGGGGAACAG
CCCGAGCAACCACCTTTGGAGGCCCCAGGGGCAGCTGCCCCCGGTGCTGGGCCTAGCCCA
GCCGAAGAGATGGAGACCGAACCGCCTCACAACGAGCCCATCCCCGTCGAGAATGATGGC
GAGGCCTGTGGACCCCCAGAGGTCTCCAGACCCAACTTTCAGGTCCTCAACCCGGCATTC
AGGGAAGCTGGAGCCCATGGAAGCTACAGCCCACCTCCTGAGGAAGCAATGCCCTTCGAG
GCTGAACAGCCCAGCTTGGGAGGCTTCTGGCCTACACTGGAGCAGCCTGGATTCCCCAGT
GGGGTCCATGCAGGCCTTGAGGCCTTCGGCCCAGCACTCATGGAGCCCGGAGCCTTCAGT
GGTGCCAGACCAGGCCTGGGAGGATACAGCCCTCCACCAGAAGAAGCTATGCCCTTTGAG
TTTGACCAGCCTGCCCAGAGAGGCTGCAGTCAACTTCTCTTACAGGTCCCAGACCTTGCT
CCAGGAGGCCCAGGTGCTGCAGGGGTCCCCGGAGCTCCTCCCGAGGAGCCCCAAGCCCTC
AGGCCTGCAAAGGCTGGCTCCAGAGGAGGCTACAGCCCTCCCCCTGAGGAGACTATGCCA
TTTGAGCTTGATGGAGAAGGATTTGGGGACGACAGCCCACCCCCGGGGCTTTCCCGAGTT
ATCGCACAAGTCGACGGCAGCAGCCAGTTCGCGGCAGTCGCGGCCTCGAGTGCGGTCCGC
CTCACTCCCGCCGCGAACGCGCCTCCCCTCTGGGTCCCAGGCGCCATCGGCAGCCCATCC
CAAGAGGCTGTCAGACCTCCTTCTAACTTCACGGGCAGCAGCCCCTGGATGGAGATCTCC
GGACCCCCGTTCGAGATTGGCAGCGCCCCCGCTGGGGTCGACGACACTCCCGTCAACATG
GACAGCCCCCCAATCGCGCTTGACGGCCCGCCCATCAAGGTCTCCGGAGCCCCAGATAAG
AGAGAGCGAGCAGAGAGACCCCCAGTTGAGGAGGAAGCAGCAGAGATGGAAGGAGCCGCT
GATGCCGCGGAGGGAGGAAAAGTACCCTCTCCGGGGTACGGATCCCCTGCCGCCGGGGCA
GCCTCAGCGGATACCGCTGCCAGGGCAGCCCCTGCAGCCCCAGCCGATCCTGACTCCGGG
GCAACCCCAGAAGATCCCGACTCCGGGACAGCACCAGCCGATCCTGACTCCGGGGCATTC
GCAGCCGATCCCGACTCCGGGGCAGCCCCTGCCGCCCCAGCCGATCCCGACTCCGGGGCG
GCCCCTGACGCCCCAGCCGATCCCGACTCCGGGGCGGCCCCTGACGCCCCAGCCGATCCA
GATGCCGGGGCGGCCCCTGAGGCTCCCGCCGCCCCTGCGGCTGCTGAGACCCGGGCAGCC
CATGTCGCCCCAGCTGCGCCAGACGCAGGGGCTCCCACTGCCCCAGCCGCTTCTGCCACC
CGGGCAGCCCAAGTCCGCCGGGCGGCCTCTGCAGCCCCTGCCTCCGGGGCCAGACGCAAG
ATCCATCTCAGACCCCCCAGCCCCGAGATCCAGGCTGCCGATCCGCCTACTCCGCGGCCT
ACTCGCGCGTCTGCCTGGCGGGGCAAGTCCGAGAGCAGCCGCGGCCGCCGCGTGTACTAC
GATGAAGGGGTGGCCAGCAGCGACGATGACTCCAGCGGAGACGAGTCCGACGATGGGACC
TCCGGATGCCTCCGCTGGTTTCAGCATCGGCGAAATCGCCGCCGCCGAAAGCCCCAGCGC
AACTTACTCCGCAACTTTCTCGTGCAAGCCTTCGGGGGCTGCTTCGGTCGATCTGAGAGT
CCCCAGCCCAAAGCCTCGCGCTCTCTCAAGGTCAAGAAGGTACCCCTGGCGGAGAAGCGC
AGACAGATGCGCAAAGAAGCCCTGGAGAAGCGGGCCCAGAAGCGCGCAGAGAAGAAACGC
AGTAAGCTCATCGACAAACAACTCCAGGACGAAAAGATGGGCTACATGTGTACGCACCGC
CTGCTGCTTCTAGGTGCTGGAGAATCTGGTAAAAGCACCATTGTGAAGCAGATGAGGATC
CTGCATGTTAATGGGTTTAATGGAGAGGGCGGCGAAGAGGACCCGCAGGCTGCAAGGAGC
AACAGCGATGGTGAGAAGGCAACCAAAGTGCAGGACATCAAAAACAACCTGAAAGAGGCG
ATTGAAACCATTGTGGCCGCCATGAGCAACCTGGTGCCCCCCGTGGAGCTGGCCAACCCC
GAGAACCAGTTCAGAGTGGACTACATCCTGAGTGTGATGAACGTGCCTGACTTTGACTTC
CCTCCCGAATTCTATGAGCATGCCAAGGCTCTGTGGGAGGATGAAGGAGTGCGTGCCTGC
TACGAACGCTCCAACGAGTACCAGCTGATTGACTGTGCCCAGTACTTCCTGGACAAGATC
GACGTGATCAAGCAGGCTGACTATGTGCCGAGCGATCAGGACCTGCTTCGCTGCCGTGTC
CTGACTTCTGGAATCTTTGAGACCAAGTTCCAGGTGGACAAAGTCAACTTCCACATGTTT
GACGTGGGTGGCCAGCGCGATGAACGCCGCAAGTGGATCCAGTGCTTCAACGATGTGACT
GCCATCATCTTCGTGGTGGCCAGCAGCAGCTACAACATGGTCATCCGGGAGGACAACCAG
ACCAACCGCCTGCAGGAGGCTCTGAACCTCTTCAAGAGCATCTGGAACAACAGATGGCTG
CGCACCATCTCTGTGATCCTGTTCCTCAACAAGCAAGATCTGCTCGCTGAGAAAGTCCTT
GCTGGGAAATCGAAGATTGAGGACTACTTTCCAGAATTTGCTCGCTACACTACTCCTGAG
GATGCTACTCCCGAGCCCGGAGAGGACCCACGCGTGACCCGGGCCAAGTACTTCATTCGA
GATGAGTTTCTGAGGATCAGCACTGCCAGTGGAGATGGGCGTCACTACTGCTACCCTCAT
TTCACCTGCGCTGTGGACACTGAGAACATCCGCCGTGTGTTCAACGACTGCCGTGACATC
ATTCAGCGCATGCACCTTCGTCAGTACGAGCTGCTCTAAGAAGGGAACCCCCAAATTTAA
TTAAAGCCTTAAGCACAATTAATTAAAAGTGAAACGTAATTGTACAAGCAGTTAATCACC
CACCATAGGGCATGATTAACAAAGCAACCTTTCCCTTCCCCCGAGTGATTTTGCGAAACC
CCCTTTTCCCTTCAGCTTGCTTAGATGTTCCAAATTTAGAAAGCTTAAGGCGGCCTACAG
AAAAAGGAAAAAAGGCCACAAAAGTTCCCTCTCACTTTCAGTAAAAATAAATAAAACAGC
AGCAGCAAACAAATAAAATGAAATAAAAGAAACAAATGAAATAAATATTGTGTTGTGCAG
CATTAAAAAAAATCAAAATAAAAATTAAATGTGAGCAAAGAATGAAAAAAAAAAAAAAAA
AAAA

Protein Sequence

>2778 : length: 1037
MGVRNCLYGNNMSGQRDIPPEIGEQPEQPPLEAPGAAAPGAGPSPAEEMETEPPHNEPIP
VENDGEACGPPEVSRPNFQVLNPAFREAGAHGSYSPPPEEAMPFEAEQPSLGGFWPTLEQ
PGFPSGVHAGLEAFGPALMEPGAFSGARPGLGGYSPPPEEAMPFEFDQPAQRGCSQLLLQ
VPDLAPGGPGAAGVPGAPPEEPQALRPAKAGSRGGYSPPPEETMPFELDGEGFGDDSPPP
GLSRVIAQVDGSSQFAAVAASSAVRLTPAANAPPLWVPGAIGSPSQEAVRPPSNFTGSSP
WMEISGPPFEIGSAPAGVDDTPVNMDSPPIALDGPPIKVSGAPDKRERAERPPVEEEAAE
MEGAADAAEGGKVPSPGYGSPAAGAASADTAARAAPAAPADPDSGATPEDPDSGTAPADP
DSGAFAADPDSGAAPAAPADPDSGAAPDAPADPDSGAAPDAPADPDAGAAPEAPAAPAAA
ETRAAHVAPAAPDAGAPTAPAASATRAAQVRRAASAAPASGARRKIHLRPPSPEIQAADP
PTPRPTRASAWRGKSESSRGRRVYYDEGVASSDDDSSGDESDDGTSGCLRWFQHRRNRRR
RKPQRNLLRNFLVQAFGGCFGRSESPQPKASRSLKVKKVPLAEKRRQMRKEALEKRAQKR
AEKKRSKLIDKQLQDEKMGYMCTHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDP
QAARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNV
PDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDL
LRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVI
REDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFAR
YTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFN
DCRDIIQRMHLRQYELL