ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2776

Name

GNAQ

Synonym

CMC1|G-ALPHA-q|GAQ|SWS;guanine nucleotide binding protein (G protein), q polypeptide;GNAQ;guanine nucleotide binding protein (G protein), q polypeptide

Definition

guanine nucleotide-binding protein G(q) subunit alpha|guanine nucleotide-binding protein alpha-q

Position

9q21

Gene Type

protein-coding

Pathways and Diseases

Pathway

Vascular smooth muscle contraction;KEGG PATHWAY;hsa04270

Pathway

pertussis toxin-insensitive ccr5 signaling in macrophage;PID BioCarta;100214

Pathway

Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway;PANTHER;P00027

Pathway

angiotensin ii mediated activation of jnk pathway via pyk2 dependent signaling;PID BioCarta;100236

Pathway

thrombin signaling and protease-activated receptors;PID BioCarta;100082

Pathway

Metabotropic glutamate receptor group I pathway;PANTHER;P00041

Pathway

effects of calcineurin in keratinocyte differentiation;PID BioCarta;100222

Pathway

5HT2 type receptor mediated signaling pathway;PANTHER;P04374

Pathway

Muscarinic acetylcholine receptor 1 and 3 signaling pathway;PANTHER;P00042

Pathway

Alzheimer's disease;KEGG PATHWAY;hsa05010

Pathway

Thyrotropin-releasing hormone receptor signaling pathway;PANTHER;P04394

Pathway

Salivary secretion;KEGG PATHWAY;hsa04970

Pathway

Huntington's disease;KEGG PATHWAY;hsa05016

Pathway

Amoebiasis;KEGG PATHWAY;hsa05146

Pathway

Melanogenesis;KEGG PATHWAY;hsa04916

Pathway

Cortocotropin releasing factor receptor signaling pathway;PANTHER;P04380

Pathway

pkc-catalyzed phosphorylation of inhibitory phosphoprotein of myosin phosphatase;PID BioCarta;100100

Pathway

Endothelin signaling pathway;PANTHER;P00019

Pathway

Diabetes pathways;Reactome;REACT:15380

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

PI3 kinase pathway;PANTHER;P00048

Pathway

signaling pathway from g-protein families;PID BioCarta;100153

Pathway

Histamine H1 receptor mediated signaling pathway;PANTHER;P04385

Pathway

Long-term potentiation;KEGG PATHWAY;hsa04720

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

links between pyk2 and map kinases;PID BioCarta;100057

Pathway

Calcium signaling pathway;KEGG PATHWAY;hsa04020

Pathway

g-protein signaling through tubby proteins;PID BioCarta;100009

Pathway

GnRH signaling pathway;KEGG PATHWAY;hsa04912

Pathway

actions of nitric oxide in the heart;PID BioCarta;100094

Pathway

Chagas disease;KEGG PATHWAY;hsa05142

Pathway

cxcr4 signaling pathway;PID BioCarta;100192

Pathway

Pancreatic secretion;KEGG PATHWAY;hsa04972

Pathway

Gap junction;KEGG PATHWAY;hsa04540

Pathway

Oxytocin receptor mediated signaling pathway;PANTHER;P04391

Pathway

Hemostasis;Reactome;REACT:604

Pathway

ccr3 signaling in eosinophils;PID BioCarta;100215

Pathway

Integration of energy metabolism;Reactome;REACT:1505

Pathway

Arf6 signaling events;PID Curated;200060

Pathway

activation of pkc through g-protein coupled receptors;PID BioCarta;100073

Pathway

Long-term depression;KEGG PATHWAY;hsa04730

Pathway

Gastric acid secretion;KEGG PATHWAY;hsa04971

Disease

Bleeding diathesis due to GNAQ deficiency;OMIM

External Links

Links to cell senescence gene database

2776

Links to epithelial mesenchymal transition gene database

2776

Links to ovarian cancer gene database

2776

Links to endometrial cancer gene database

2776

Links to iHOP

2776

Sequence Information

Nucleotide Sequence

>2776 : length: 6343
AGACTATCCGCTCCCACCGCGCCCCCGGCCCACCTGGTGGCCCCGGCCCTGGCCGCCGCC
CCCGCGGCGGTTCCCGGAGCTCGTCCCGGACGCGCGCCCGGGCGGCGGGGGCTCGGCGGC
CACCGCTGCCTCGGGGGAGCGAGGGCGGGAGGGTGTGTGTGCGCGCTGTGAGCAGGGGGT
GCCGGCGGGGCTGCAGCGGAGGCACTTTGGAAGAATGACTCTGGAGTCCATCATGGCGTG
CTGCCTGAGCGAGGAGGCCAAGGAAGCCCGGCGGATCAACGACGAGATCGAGCGGCAGCT
CCGCAGGGACAAGCGGGACGCCCGCCGGGAGCTCAAGCTGCTGCTGCTCGGGACAGGAGA
GAGTGGCAAGAGTACGTTTATCAAGCAGATGAGAATCATCCATGGGTCAGGATACTCTGA
TGAAGATAAAAGGGGCTTCACCAAGCTGGTGTATCAGAACATCTTCACGGCCATGCAGGC
CATGATCAGAGCCATGGACACACTCAAGATCCCATACAAGTATGAGCACAATAAGGCTCA
TGCACAATTAGTTCGAGAAGTTGATGTGGAGAAGGTGTCTGCTTTTGAGAATCCATATGT
AGATGCAATAAAGAGTTTATGGAATGATCCTGGAATCCAGGAATGCTATGATAGACGACG
AGAATATCAATTATCTGACTCTACCAAATACTATCTTAATGACTTGGACCGCGTAGCTGA
CCCTGCCTACCTGCCTACGCAACAAGATGTGCTTAGAGTTCGAGTCCCCACCACAGGGAT
CATCGAATACCCCTTTGACTTACAAAGTGTCATTTTCAGAATGGTCGATGTAGGGGGCCA
AAGGTCAGAGAGAAGAAAATGGATACACTGCTTTGAAAATGTCACCTCTATCATGTTTCT
AGTAGCGCTTAGTGAATATGATCAAGTTCTCGTGGAGTCAGACAATGAGAACCGAATGGA
GGAAAGCAAGGCTCTCTTTAGAACAATTATCACATACCCCTGGTTCCAGAACTCCTCGGT
TATTCTGTTCTTAAACAAGAAAGATCTTCTAGAGGAGAAAATCATGTATTCCCATCTAGT
CGACTACTTCCCAGAATATGATGGACCCCAGAGAGATGCCCAGGCAGCCCGAGAATTCAT
TCTGAAGATGTTCGTGGACCTGAACCCAGACAGTGACAAAATTATCTACTCCCACTTCAC
GTGCGCCACAGACACCGAGAATATCCGCTTTGTCTTTGCTGCCGTCAAGGACACCATCCT
CCAGTTGAACCTGAAGGAGTACAATCTGGTCTAATTGTGCCTCCTAGACACCCGCCCTGC
CCTTCCCTGGTGGGCTATTGAAGATACACAAGAGGGACTGTATTTCTGTGGAAAACAATT
TGCATAATACTAATTTATTGCCGTCCTGGACTCTGTGTGAGCGTGTCCACAGAGTTTGTA
GTAAATATTATGATTTTATTTAAACTATTCAGAGGAAAAACAGAGGATGCTGAAGTACAG
TCCCAGCACATTTCCTCTCTATCTTTTTTTTAGGCAAAACCTTGTGACTCAGTGTATTTT
AAATTCTCAGTCATGCACTCACAAAGATAAGACTTGTTTCTTTCTGTCTCTCTCTCTTTT
TCTTTTCTATGGAGCAAAACAAAGCTGATTTCCCTTTTTTCTTCCCCCGCTAATTCATAC
CTCCCTCCTGATGTTTTTCCCAGGTTACAATGGCCTTTATCCTAGTTCCATTCTTGGTCA
AGTTTTTCTCTCAAATGATACAGTCAGGACACATCGTTCGATTTAAGCCATCATCAGCTT
AATTTAAGTTTGTAGTTTTTGCTGAAGGATTATATGTATTAATACTTACGGTTTTAAATG
TGTTGCTTTGGATACACACATAGTTTCTTTTTTAATAGAATATACTGTCTTGTCTCACTT
TGGACTGGGACAGTGGATGCCCATCTAAAAGTTAAGTGTCATTTCTTTTAGATGTTTACC
TTCAGCCATAGCTTGATTGCTCAGAGAAATATGCAGAAGGCAGGATCAAAGACACACAGG
AGTCCTTTCTTTTGAAATGCCACGTGCCATTGTCTTTCCTCCCTTCTTTGCTTCTTTTTC
TTACCCTCTCTTTCAATTGCAGATGCCAAAAAAGATGCCAACAGACACTACATTACCCTA
ATGGCTGCTACCCAGAACCTTTTTATAGGTTGTTCTTAATTTTTTTGTTGTTGTTGTTCA
AGCTTTTCCTTTCTTTTTTTTCTTGGTGTTTGGGCCACGATTTTAAAATGACTTTTATTA
TGGGTATGTGTTGCCAAAGCTGGCTTTTTGTCAAATAAAATGAATACGAACTTAAAAAAT
AAAAGCTGGTATCTTAAAATGTAAGAGAGTAAGACTGTGAAGCCTAAAATGACTGGCTGA
GAATGAACCAGAAATGCCATTTGCCAAACAGTTGTAACTAGAAATTTGATTCTCACGGTC
CATTCTTTTCTTTGTCCTTAAGATGACATTGTTAGTGTTCACGTCCCATGTTCAGTGTCC
AAACCGGCAATGTAAAAAGTATCCTGTGTGGTTTAACAGGAAATCTGTTTATGTCTCTTT
ATTTGAAACCAGTTTTACTCTCAGTGGTTCTTTAAGTTCAATGAAGTCTGCCAGGAACAT
TGGTTGGTAGTATTATTCCGACACCTTTAATTTCCAAAATCTGAAGTTCCTGCTAGTTTA
CCACCTTCATGATCTTCTTGAACTGGTAACTGATTAGGTTGAACTTATGGAAGATTTGTG
GACTTAACTCAAAAGTAACCTCTCAGTGTTCTATAGAACATGTATTTGTGTAACTGAACC
TACCAGGAGAAATGTTTGGAATTCTATATGTGCAATTTTTCAACAAATGCAAAAAAAATA
CAGCACATGTATTGACAAGCTTCTGTCAAGCAGCTTGAGTTGAAATTTGATTTAAGAAAA
TAAATCATGATTGTTCAAAGCTGCTGGGACGTTAGAATTAGGCCATGATACTGGTCTCAT
TTTAACTACAGTGGTATTTGGCACTAGTGTAAACTTCCATATAAATCACTCTTTTGGAAC
AACAAAGGGGGAGGGAGAAAAATCACGGCCTGTTAAATGAGTACCAAAGCCGCCCAACAG
TAATGAGATGTTCTCATCCTTGATTCTCCCAGCCTCAAACAACACAGCTTACTTTTTTTT
TCCCTTGCTCAGAAAGTACCTGTAATTTAACAAACAGACTGCCTGTAGGTATAGTGCAAT
TACAAATGCTCTAATCATTGTACATACATCTCTCTTGATATTGCAGCATCCATACTGGCT
TTGTAATCATTAATTTTTTGGCAGATTGAATGTGCTGTATTGATATGTATCTATGTAATT
GTATTGTATGTCTATAGCTAATTCACGTTTTGAATAATGTTATTTTATTTACTTTTTTAA
GAGAGGAGAATGTAAATTTGTCAGTTTATTTCTGACTAGGGATATTTTCTTTCCATTTAG
AAAAGAAGAAAAAAAAAAAACCTTACTGTCATACAGAGCGGTACTAGCGTCGTGCTGTAT
AAAATCATTTGCACATTCCTGAGTAGAGGTATACTGATTATAAGACCCAAAGGTAATTTC
ATAGCAAAATACATAAAATCAGTCGGAGCTTTTATACAAACATGGAAACCAACTTTGTAG
AACTTTTGCCATTTGATCTAGGATTGGAATATGAGCTTTTATACAATTCATATTCTTATT
TGGCAAATGCACAGTTTAGTATTACCTCTCTGATGGCCTTTACTAGAAAGGCAGTTTTAG
AAGCTATTGTGATCCACTAAGGAAATGTTTTAACAGCTAGAGACCACTGCTTGCCTGAAA
GGGCGTTCTTAAATTTGGTGCAGCAAAAAAAAAAAAAAAAAAAAAAAAAATTAAACAACA
ACATTTGAAGGCCTACAGTGTGTATAGAGAAAACCTCATCACAAGATCATAAGTGTTACA
GTTTTAGGGAATCAAGATATTCTATTTAATAGAGCTATAGTAAATGTAGTCAATTAAACC
TGATCTCAAAGCTTGAAGAAGCTGAGCAAAACAGGGAAAGATTGTTATATTTGTCTTTAT
GAAATTGGGATGGAATTTGCTATGCAGAATTGAGGTTTGTGGCTTCGCTGTTCCTGTAGG
GTGCATGACAAGATCCCTTCTCTTGAGAAAGGAAAAAATTGATCACCCTAGCAGCAGTGA
TGCATAGAAACCTAATTTTAGCCACACCAGTCAATCGAAGCTAAAGGATTTTCTTTTTTG
TTTCTTCGGGGTTTTATTGAAGGGGCTAGGGGCGGGACGGGATTCTTTTCAGTTTTGTAT
AAAAACAAAGTTTACTCATGCTTTATATTATATTGTGATTGCAAGCGTTATAAGCGTGTG
CCACTGGCCTCCTATTGTTGATGCTTAGGTAATGGAGGCCTGTGGTGAGTTTTATGGTGA
CTTGGGCATGTCTTATTCAAAAACAAAAACATAAAACACAGAAACCTTTCTTCAGCATAC
CAAGGCAAGCAGCCATTTCATGACTCACTTAACACATTGCAGTGTACCAGTTTACAGATG
ATTTTTCCCTTTTTGCGTGACATGGCAGTTCTAACCCCCAGAGAATTCCTTATTTGTAAA
TTGGAAGTTTCTACTATGCCTTACAGAGCTTAAATTCAGAAGTTTGTGCCTCATATCTGA
AACAAAGGGAAATAACACACCCATTCAAAAGTAAATAAATCTCCTAGAAGTTTTTGTTTT
TAACATTTCCATATAAAGAGCTCTGTTGAATGTCATGAATAGACTGGAAAAAAAAATTTT
AAGAACCTGCATATGTTGTTTACTAGCAGATGACAACTACAAAAGGAATCTGAAGAACAC
GTAAAACTTGTATTTTTTTTTTTTTGGTAGATTAACTAGCAGGCCTATTTTAAAAAGGTA
ATTCAGCTAAAGGGCAATTTACTTTTTTGTACTTCAGACTATCTTGATTGTCAAAGTGTA
CGAACTGTAATTTTAAAATTTATACTGCCACATGATTGTAAATTTTAGTTGTCTTAAGTT
AGGAATTGGTGAAAAGCTATTTATGCTGGATTTGGGTCAAAATGACTTATTTGCAAAAAA
ATAAATAATGGGAAGAAAGGGCTGTATAATGAAATACTGCAAGACTCACATATTGGTTGG
AAATTTCCCTCAAATCACCTACCGATTACCCTTGATTTCCCTTTGTTTTCAGTTTCTCAA
AACGAATGAAATGAAATATAGCAGAATGTTAACCCATATAAAAATAAAGTGTACCCAAAT
ATTGTAATGTATATTGCTGCTCTTCTTCAAATTAAATAAGGGTTTAAAACCACTTAATTG
GTAATCAACATCTCAATTGATACAAATAAGGTGTGCTTGGTATACATTAATATTTTCTTC
CAAAGATATATCTTTGGTTAGAAACACAAAAAAATAAAACTAGTAATATTGTATGTTTAT
CTATCTCTACATATTTCCAGCATATGTAGCGTTAATAGATCTGTCCTGGTAACTGTGTCT
TTGGGATTTCATTTTGGTTCCATCAAATTAGGAAAAGAAATGGCTTAGTTGTATATGATT
AGCTAGAGATTTTTGGAGCCAGACACCTGCTGTTTAGTAGATAACTTAGTACAGACCCTA
AACTTGTCATTTGTTTTTCTCACAGAATAGCCATTTCCTGCTGTCTTCCCAATGATCACT
GCCCTTTCAATAACACTCTTGCCTCTAGAATCATATGTTCAAAGTATGAATACACACCTA
GCACATAGTAGGTGCTCAAATATTAATTTCCTCCTTGCCTTCCTTATCTACCCTGTGTCC
TCCATTTCCCCGTATGATTCCAACCCAATATAGCAAATGACATTTACATGTTATGAAAAC
ATCTATTGGGTAAAATCAGATCTTGGATAAAGAAATTCTGACTTTTATATAAGCTTTTGG
TAGACAGAAAAAACAGAAAGGTATTCGTTGGTAGAACATTTTTAAGTTCAGGAAAGAAAG
CTGGAATAATACTACGTAACTTTGTCCAGGTTACTTTGACTGAAACACGTTTTTGGTGGA
TTTCTTTTCCTCAAAGAACTCTCTAAATGCAACTCCTTGCTGGATTCCTCACCCATCATC
CTGTTGGAAACCCTTACTAGACCTATGTATTTAGGGAGTTTTGTCAGAAAACATTTTTAA
CTTGCAGTATTTAAAAGAATATTTACTGTTCCTAAAATGTCATTCAAATGCATGTACTGT
CTATTGTTTGGGGATGGGAACTAGTTTTGCAAAAAACACCTAATGTTGTATAATAATGCC
CCAATGATCTTGCTGGTTAAAAATACAGTATTTTTGGCCATAA

Protein Sequence

>2776 : length: 359
MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK
VSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVL
RVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV