ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2768

Name

GNA12

Synonym

NNX3|RMP|gep;guanine nucleotide binding protein (G protein) alpha 12;GNA12;guanine nucleotide binding protein (G protein) alpha 12

Definition

G-protein subunit alpha-12|WUGSC:H_GS165O14.2|g alpha-12|guanine nucleotide-binding protein subunit alpha-12

Position

7p22.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Vascular smooth muscle contraction;KEGG PATHWAY;hsa04270

Pathway

LPA receptor mediated events;PID Curated;200011

Pathway

S1P3 pathway;PID Curated;200035

Pathway

S1P5 pathway;PID Curated;200063

Pathway

Hemostasis;Reactome;REACT:604

Pathway

Endothelins;PID Curated;200004

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

rho-selective guanine exchange factor akap13 mediates stress fiber formation;PID BioCarta;100248

Pathway

pkc-catalyzed phosphorylation of inhibitory phosphoprotein of myosin phosphatase;PID BioCarta;100100

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

S1P2 pathway;PID Curated;200181

Pathway

Long-term depression;KEGG PATHWAY;hsa04730

Pathway

S1P4 pathway;PID Curated;200043

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Sphingosine 1-phosphate (S1P) pathway;PID Curated;200104

Disease

Height;NHGRI

Disease

Prostate cancer;FunDO

Disease

Azoospermia;FunDO

Disease

height;GAD

Disease

Leukemia;FunDO

Disease

Hyperaldosteronism;FunDO

Disease

Breast cancer;FunDO

Disease

DEVELOPMENTAL;GAD

Disease

Congenital abnormality;FunDO

Disease

Neoplasm metastasis;FunDO

External Links

Links to cell senescence gene database

2768

Links to epithelial mesenchymal transition gene database

2768

Links to ovarian cancer gene database

2768

Links to endometrial cancer gene database

2768

Links to iHOP

2768

Sequence Information

Nucleotide Sequence

>2768 : length: 4398
GGGCGACGAGTGCGGGCCTCGGAGCGACTGCAGCGGCGGCGGCGGACGCGGCCTGAGGCG
AGCGGCGGGGCGTGGGGCGGTGCCTCGGCCCGGGCTCGCCCTCGCCGGCGGGAGCGTCCA
TGGCCCCCGGGCGCCGGCGGGGCGCGGCCGCGGCCTGAGGGGCCATGTCCGGGGTGGTGC
GGACCCTCAGCCGCTGCCTGCTGCCGGCCGAGGCCGGCGGGGCCCGCGAGCGCAGGGCGG
GCAGCGGCGCGCGCGACGCGGAGCGCGAGGCCCGGAGGCGTAGCCGCGACATCGACGCGC
TGCTGGCCCGCGAGCGGCGCGCGGTCCGGCGCCTGGTGAAGATCCTGCTGCTGGGCGCGG
GCGAGAGCGGCAAGTCCACGTTCCTCAAGCAGATGCGCATCATCCACGGCCGCGAGTTCG
ACCAGAAGGCGCTGCTGGAGTTCCGCGACACCATCTTCGACAACATCCTCAAGGGCTCAA
GGGTTCTTGTTGATGCACGAGATAAGCTTGGCATTCCTTGGCAGTATTCTGAAAATGAGA
AGCATGGGATGTTCCTGATGGCCTTCGAGAACAAGGCGGGGCTGCCTGTGGAGCCGGCCA
CCTTCCAGCTGTACGTCCCGGCCCTGAGCGCACTCTGGAGGGATTCTGGCATCAGGGAGG
CTTTCAGCCGGAGAAGCGAGTTTCAGCTGGGGGAGTCGGTGAAGTACTTCCTGGACAACT
TGGACCGGATCGGCCAGCTGAATTACTTTCCTAGTAAGCAAGATATCCTGCTGGCTAGGA
AAGCCACCAAGGGAATTGTGGAGCATGACTTCGTTATTAAGAAGATCCCCTTTAAGATGG
TGGATGTGGGCGGCCAGCGGTCCCAGCGCCAGAAGTGGTTCCAGTGCTTCGACGGGATCA
CGTCCATCCTGTTCATGGTCTCCTCCAGCGAGTACGACCAGGTCCTCATGGAGGACAGGC
GCACCAACCGGCTGGTGGAGTCCATGAACATCTTCGAGACCATCGTCAACAACAAGCTCT
TCTTCAACGTCTCCATCATTCTCTTCCTCAACAAGATGGACCTCCTGGTGGAGAAGGTGA
AGACCGTGAGCATCAAGAAGCACTTCCCGGACTTCAGGGGCGACCCGCACAGGCTGGAGG
ACGTCCAGCGCTACCTGGTCCAGTGCTTCGACAGGAAGAGACGGAACCGCAGCAAGCCAC
TCTTCCACCACTTCACCACCGCCATCGACACCGAGAACGTCCGCTTCGTGTTCCATGCTG
TGAAAGACACCATCCTGCAGGAGAACCTGAAGGACATCATGCTGCAGTGAGCGAGGAAGC
CCCGGGGTTTGTCGTCGTTGAGCAGCCCCCACGGCTGTCGGTCAGACTCTTGGGTGTGTG
TTGTCTGTGTGGTCCTTGAGTGGGTTTCTCGGATCCGTGCCCTGGAATACCTGGCTCAGG
AATGCTGTCAGACCAGCCAGCCAGCGAGCTCTAGGCAAAAGGACATGGAAACTGTCACGT
TAGCTACTGAATCCTGGGGGCGAGTGAAACTACTGAAAATCCGAGTGATGATGTTGTGAA
TACGGAACACCTAATCACACAGCTTGCTTTGCTTTTACAGAAACGTTCCTCTTTTTCTGA
CGCAGTTTAATTGAGGACCGTGTTGTGTGTGTATGTGTGTACACACGCTCTGTCTTTAAT
GACAGAAACACAAAAACCAGCTGGCCTTGCAGACGGCTTTTCTAACTCACAAGTCTTCCC
TGAGACAGACTAACCTGAAAGCTTTGCCTAACAGTAGCTTGTAGAGATCCAGTGCACGCC
GATGCTGCTAAACTCAGTGCCTGAGCCCGGCCCTGCAGCCCCAGCCGCAGTGTCTGAAGG
CCACCTCCCAAAGGGAGCACGTTGCCTTTTCAAACTCCCGTGCCGATTTCCTAAGAGCCC
CTAGTCCAAGCCTCTCAGATGAAGCTGAGGAGCCGTGCCTAGGATCCCTTCCCAGCTCTG
AGGACGGGCTGCAGAGCTCTGCAGGTGTGGATTCACCTTACGCCCCTACAGCAGGCTCAG
CCCTTCCCACCCTGCCCCATGCCCAGCAGCACAACACGGAGTGAGACAGGATGCCCACGG
TGACTGCCGCTCCGTCCGTGCACACACAGCGGTGCTCTTCTCCCCTTAGCCACCCACTGC
CCAACCCAACGGCAAAGACACAGAAACCAGGTCCCCTTGCAGACGGCTCTCCCATCTTCC
TGCAAGTCATCTGCTCACACACAGTTGGCAGCACATAGCGTTTCCTTCTTTCAGAAACAT
TCCTCTTCTGGGGCTTCAGAAAGCTGGCAAGGCCACTAGCAGAGCTTTTGTTAATGCCCC
AGCTGCTTGGCGAGCTAACAGCTGACCTTTCGGGAAGCCCACAGACGCTGGAGGAATCTT
GAGTTTCTCCAAACTGCCGCTCCACCAGTGCCTTTGGACAGCCGTGCCTGTTCGCCGCTC
TCCCTAAGTCTGATTCTCATCGAGGCCCCTCGCTTCTATGACTGTGCTTGCAGAAGAGTA
AACACTCTCGGATGCCGCTGTCCTGGGGGAGCCCGCGGGAGCCTGTGAATGTTGATACGA
GCTGGCCAGTCCTGGGCCCAGCTCACTTGTCCAGCTACCTGCCAGGTGGCTTTCACTGTG
TTTAAAATACATTGCATTCCAAGCTGGTCCCCTCTGTGTATCACTCTACTGAGAAATCCT
GCCTAGTGTGTTTTGGGATGTGTCCTAGCATTTACAAGAAAATGAAAAGCGTCCTCTTAA
TTGGCACCCGAATGTTGCTGTGGCTCAGTCACATATCCCAGGGCCCTCGTCCCGAGGCCG
TGCTGCCCCGAGCCCCGAGCCCCTCTGCAGCTCACCCTTGGCTTGTTTTCCGCAAACCCG
GTAAACGCAAGCCCTTGGGGCAGATGCAGAAGCAGAAGAGGGAGGGGAAACCTGCCTCTG
GGTCACCCTGTTAGCACAGCGTTCTCATCGGGAGACAGCATGGAACTCTCTCTCGCAGTG
CTCGAGGCTGTGTGTCAGTGTTTGCTGGGCTTGTGGCTCCTTTTTTGGCTGGATAAAGAA
GTCGCTGTTTTTGTACTGCTTCTGTGGCTCTTCACAGACCTCACGGATGTGACCGGAGAT
GAGTGCCGATGACCACGTTTTAAAGGAGAAAGAGAGCTCCTGGTGGGGCCCTCGGGGTGG
TCTCAGGTCCCATTTGCAGTCTGCAACAGTGACGCGCAGCCCGGTCCGGAGCGTGGTGAG
CTTTGTTTGCCTTCTGGGTCAGCTTTCGCTGTGTCTCCTGTGTGTGTTAGAATCCAGAGC
CCAGAGGAAGTGCAAGCGGGTCCTCCGCCAACGGGGAGAGCCTCTTCGCGGCGCTGTTGG
CGACAGCAGCGCTGTGATTCGCGTAGCAGGGGAGTTGTTTGAAACACCTTCCTGAGTAGT
CCGGCCTTGTCAATGAGTGCTTGTTTTCCTTTAAACAGTCTGACATATTTACTCGTCACT
TTCAAACCAGAAGCATGAGAGGAAGGAGATATTGTGGGGTCCGTTTAACTCGATAGAAAG
CGCAGGGGGATGGCCCCCGGCGCGGGCTCTTGACCCGCTCAGCGCTGACCCCACCGCCCT
GGCCGAGGCACTTGGCCTTGCTGAGCTGGACTTCCTCCTCCTCCTCCTCATGACCGGGGT
GAATTAGAACGTTTTTAAAGACACCCCCTTCCAAATTCTGTAACACATTGTAATTGGAGA
AGAAGGAAACTCTGCAAGGCTAAACTGTCATTCACAACTTGGCTACACATAGACTCTAGT
CAGTTTTGTCTCCAGAACCTTAGGCTTTTGTATTTTTTAATTTTAATTTCACTGTTAATC
CTTATTGTCTTTTTTATTAAGATGTTGGAAAAGCAGGAGGTAGTTGTGCCTCAATTATTG
CAAAAATGTAACAATAAAGTTCCTCAAAATAAGATCTGTTCCTCATAGCTATACTGTGTA
CACATAAGACGCATATAGGGTTTTACTGAAATCTATTTTTAACTCTTATGTTCGTAGAGA
AATTGTTTCAAGGATTTTGAGTCATAGGTCTGTAATTTATAGAGATCTCTAGAATTCTTA
TTGTAATTTTCCTACTTCTTTGATAAAAGAAAAATAAGTCAGATTGTTAACTCCAAGATT
GAAAAAAAAAACTCTTGAAAGAAGATTATTAGTTGTAACTAATTTAGGGGTTCTGGGCAC
AGACATCTAACCTGGTATTGTAAGGCAGAGGCTCCCATTGGAATGGTAGTGGTCCGGGTC
AGTTGTTCATGGTGTAAGCTTTGCACAGTGTATTAACATTGGGAGGGTCTGGCTTGAAAA
TTTGGCCACCCTCAGCCTCTGAATGTTTATTAAAATAAATTTAGTCTTTCTTTGCTTAAT
ATAAAAAAAAAAAAAAAA

Protein Sequence

>2768 : length: 381
MSGVVRTLSRCLLPAEAGGARERRAGSGARDAEREARRRSRDIDALLARERRAVRRLVKI
LLLGAGESGKSTFLKQMRIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPWQ
YSENEKHGMFLMAFENKAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSEFQLGESVK
YFLDNLDRIGQLNYFPSKQDILLARKATKGIVEHDFVIKKIPFKMVDVGGQRSQRQKWFQ
CFDGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFETIVNNKLFFNVSIILFLNKMDL
LVEKVKTVSIKKHFPDFRGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHFTTAIDTENVR
FVFHAVKDTILQENLKDIMLQ