ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

27436

Name

EML4

Synonym

C2orf2|ELP120|EMAP-4|EMAPL4|ROPP120;echinoderm microtubule associated protein like 4;EML4;echinoderm microtubule associated protein like 4

Definition

echinoderm microtubule-associated protein-like 4|restrictedly overexpressed proliferation-associated protein|ropp 120

Position

2p21

Gene Type

protein-coding

External Links

Links to cell senescence gene database

27436

Links to epithelial mesenchymal transition gene database

27436

Links to ovarian cancer gene database

27436

Links to endometrial cancer gene database

27436

Links to iHOP

27436

Sequence Information

Nucleotide Sequence

>27436 : length: 5695
AGGCGGCTGAGCGGCGCGGCTCTCAACGTGACGGGGAAGTGGTTCGGGCGGCCGCGGCTT
ACTACCCCAGGGCGAACGGACGGACGACGGAGGCGGGAGCCGGTAGCCGAGCCGGGCGAC
CTAGAGAACGAGCGGGTCAGGCTCAGCGTCGGCCACTCTGTCGGTCCGCTGAATGAAGTG
CCCGCCCCTCTAAGCCCGGAGCCCGGCGCTTTCCCCGCAAGATGGACGGTTTCGCCGGCA
GTCTCGTGAAGATTGGTAATTGAGAGTCCTGAAAATGGCAGTATTTGGATATGAGTATGC
TACAGTATTGACACTTTCTGAAAGTCGGACATCAGTATGCGAGAGCGTACTTCGTGATAG
CAGCTCACACTTTCAATTTCACCTCTTCTTTGGTGGACAGATGATAGTATTTCTGCTGCA
AGTACTTCTGATGTTCAAGATCGCCTGTCAGCTCTTGAGTCACGAGTTCAGCAACAAGAA
GATGAAATCACTGTGCTAAAGGCGGCTTTGGCTGATGTTTTGAGGCGTCTTGCAATCTCT
GAAGATCATGTGGCCTCAGTGAAAAAATCAGTCTCAAGTAAAGGCCAACCAAGCCCTCGA
GCAGTTATTCCCATGTCCTGTATAACCAATGGAAGTGGTGCAAACAGAAAACCAAGTCAT
ACCAGTGCTGTCTCAATTGCAGGAAAAGAAACTCTTTCATCTGCTGCTAAAAGTGGTACA
GAAAAAAAGAAAGAAAAACCACAAGGACAGAGAGAAAAAAAAGAGGAATCTCATTCTAAT
GATCAAAGTCCACAAATTCGAGCATCACCTTCTCCCCAGCCCTCTTCACAACCTCTCCAA
ATACACAGACAAACTCCAGAAAGCAAGAATGCTACTCCCACCAAAAGCATAAAACGACCA
TCACCAGCTGAAAAGTCACATAATTCTTGGGAAAATTCAGATGATAGCCGTAATAAATTG
TCGAAAATACCTTCAACACCCAAATTAATACCAAAAGTTACCAAAACTGCAGACAAGCAT
AAAGATGTCATCATCAACCAAGCAAAAATGTCAACTCGCGAAAAAAACAGCCAAGAAGGA
GAATATATTAAAATGTTTATGCGCGGTCGGCCAATTACCATGTTCATTCCTTCCGATGTT
GACAACTATGATGACATCAGAACGGAACTGCCTCCTGAGAAGCTCAAACTGGAGTGGGCA
TATGGTTATCGAGGAAAGGACTGTAGAGCTAATGTTTACCTTCTTCCGACCGGGAAAATA
GTTTATTTCATTGCATCAGTAGTAGTACTATTTAATTATGAGGAGAGAACTCAGCGACAC
TACCTGGGCCATACAGACTGTGTGAAATGCCTTGCTATACATCCTGACAAAATTAGGATT
GCAACTGGACAGATAGCTGGCGTGGATAAAGATGGAAGGCCTCTACAACCCCACGTCAGA
GTGTGGGATTCTGTTACTCTATCCACACTGCAGATTATTGGACTTGGCACTTTTGAGCGT
GGAGTAGGATGCCTGGATTTTTCAAAAGCAGATTCAGGTGTTCATTTATGTATTATTGAT
GACTCCAATGAGCATATGCTTACTGTATGGGACTGGCAGAAGAAAGCAAAAGGAGCAGAA
ATAAAGACAACAAATGAAGTTGTTTTGGCTGTGGAGTTTCACCCAACAGATGCAAATACC
ATAATTACATGCGGTAAATCTCATATTTTCTTCTGGACCTGGAGCGGCAATTCACTAACA
AGAAAACAGGGAATTTTTGGGAAATATGAAAAGCCAAAATTTGTGCAGTGTTTAGCATTC
TTGGGGAATGGAGATGTTCTTACTGGAGACTCAGGTGGAGTCATGCTTATATGGAGCAAA
ACTACTGTAGAGCCCACACCTGGGAAAGGACCTAAAGGTGTATATCAAATCAGCAAACAA
ATCAAAGCTCATGATGGCAGTGTGTTCACACTTTGTCAGATGAGAAATGGGATGTTATTA
ACTGGAGGAGGGAAAGACAGAAAAATAATTCTGTGGGATCATGATCTGAATCCTGAAAGA
GAAATAGAGGTTCCTGATCAGTATGGCACAATCAGAGCTGTAGCAGAAGGAAAGGCAGAT
CAATTTTTAGTAGGCACATCACGAAACTTTATTTTACGAGGAACATTTAATGATGGCTTC
CAAATAGAAGTACAGGGTCATACAGATGAGCTTTGGGGTCTTGCCACACATCCCTTCAAA
GATTTGCTCTTGACATGTGCTCAGGACAGGCAGGTGTGCCTGTGGAACTCAATGGAACAC
AGGCTGGAATGGACCAGGCTGGTAGATGAACCAGGACACTGTGCAGATTTTCATCCAAGT
GGCACAGTGGTGGCCATAGGAACGCACTCAGGCAGGTGGTTTGTTCTGGATGCAGAAACC
AGAGATCTAGTTTCTATCCACACAGACGGGAATGAACAGCTCTCTGTGATGCGCTACTCA
ATAGATGGTACCTTCCTGGCTGTAGGATCTCATGACAACTTTATTTACCTCTATGTAGTC
TCTGAAAATGGAAGAAAATATAGCAGATATGGAAGGTGCACTGGACATTCCAGCTACATC
ACACACCTTGACTGGTCCCCAGACAACAAGTATATAATGTCTAACTCGGGAGACTATGAA
ATATTGTACTGGGACATTCCAAATGGCTGCAAACTAATCAGGAATCGATCGGATTGTAAG
GACATTGATTGGACGACATATACCTGTGTGCTAGGATTTCAAGTATTTGGTGTCTGGCCA
GAAGGATCTGATGGGACAGATATCAATGCACTGGTGCGATCCCACAATAGAAAGGTGATA
GCTGTTGCCGATGACTTTTGTAAAGTCCATCTGTTTCAGTATCCCTGCTCCAAAGCAAAG
GCTCCCAGTCACAAGTACAGTGCCCACAGCAGCCATGTCACCAATGTCAGTTTTACTCAC
AATGACAGTCACCTGATATCAACTGGTGGAAAAGACATGAGCATCATTCAGTGGAAACTT
GTGGAAAAGTTATCTTTGCCTCAGAATGAGACTGTAGCGGATACTACTCTAACCAAAGCC
CCCGTCTCTTCCACTGAAAGTGTCATCCAATCTAATACTCCCACACCGCCTCCTTCTCAG
CCCTTAAATGAGACAGCTGAAGAGGAAAGTAGAATAAGCAGTTCTCCCACACTTCTGGAG
AACAGCCTGGAACAAACTGTGGAGCCAAGTGAAGACCACAGCGAGGAGGAGAGTGAAGAG
GGCAGCGGAGACCTTGGTGAGCCTCTTTATGAAGAGCCATGCAACGAGATAAGCAAGGAG
CAGGCCAAAGCCACCCTTCTGGAGGACCAGCAAGACCCTTCGCCCTCGTCCTAACACCCT
GGCTTCAGTGCAACTCTTTTCCTTCAGCTGCATGTGATTTTGTGATAAAGTTCAGGTAAC
AGGATGGGCAGTGATGGAGAATCACTGTTGATTGAGATTTTGGTTTCCATGTGATTTGTT
TTCTTCAATAGTCTTATTTTCAGTCTCTCAAATACAGCCAACTTAAAGTTTTAGTTTGGT
GTTTATTGAAAATTAACCAAACTTAATACTAGGAGAAGACTGAATCATTAATGATGTCTC
ACAAATTACTGTGTACCTAAGTGGTGTGATGTAAATACTGGAAACAAAAACAGCAGTTGC
ATTGATTTTGAAAACAAACCCCCTTGTTATCTGAACATGTTTTCTTCAGGAACAACCAGA
GGTATCACAAACACTGTTACTCATCTACTGGCTCAGACTGTACTACTTTTTTTTTTTTTT
TTCCTGAAAAAGAAACCAGAAAAAAATGTACTCTTACTGAGATACCCTCTCACCCCAAAT
GTGTAATGGAAAATTTTTAATTAAGAAAAACTTCAGTTTTGCCAAGTGCAATGGTGTTGC
CTTCTTTAAAAAATGCCGTTTTCTTACACTACCAGTGGATGTCCAGACATGCTCTTAGTC
TACTAGAGAGGTGCTGCCTTTTCTAAGTCATAATGAGGAACAGTCCCTTAATTTCTTGTG
TGCAACTCTGTTTTATCCTAGAACTAAGAGAGCATTGGTTTGTTAAAGAGCTTTCAATGT
ATATTAAAACCTTCAATACTCAGAAATGATGGATTCCTCCAAGGAGTCCTTTACTAGCCT
AAACATTCTCAAATGTTTGAGATTCAAGTGAATGGAAGGAAAACCACATGCCTTTAAAAC
TAAACTGTAATAATTACCTGGCTAATTTCAGCTAAGCCTTCATCATAATTTGTTCCCTCA
GTAATAGGAGAAATATAAATACAGTAAGTTTAGATTATTGAATTGGTGCTTGAAATTTAT
TGGTTTTGTTGTAATTTTATACAGATTATATGAGGGATAAGATACTCATCAAATTGCAAA
TTCTTTTTTTTACAGAAGTGTGGGTAACAGTCACAGCAGTTTTTTTTACCAACAGCATAC
TTAACAGACTTGCTGTGTAGCAGTTTTTTTCTGGTGGAGTTGCTGTAAGTCTTGTAAGTC
TAATGTGGCTATCCTACTCTTTTGGGCAATGCATGTATTATGCATTGGAAAGGTATTTTT
TTTAAGTTCTGTTGGCTAGCTATGGTTTTCAGTACATTTCCTACTTTAAGAGTAATTACT
GACAAATATGTATTTCCTATATGTTTATACTTTGATTATAAAAAAGTATTTTGTTTTGAT
TTTTTAACTTGCTGCATTGTTTTGATACTTTCTATTTTTTTGGTCAAATCATGTTTAGAA
ACTTTGGATGAGTTAAGAAGTCTTAAGTATGCAGGCGTTTACGTGATTGTGCCATTCCAA
AGTGCATCAGAACTGTCATTCCCTTCTAATATCTTCTCAGGAGTAATACAAATCAGGTAT
TTCATCATCATTTGGTAATATGAAAACTCCAGTGAACTCCCAAGGACATTTACAACATTT
ATATTCACACGCTGTATGGAAGGGTGTGGGTGTGTGTGAAGGGGCGAGTGGAGACACTGT
GTGTATCTCTAGATAAGAAGATATGCACCACGTTGAAAATACTCAGTGTAGATCTCTATG
TGTATAGGTATCTGTATATCTTTCCTTTTGTTTACAACTGTTAAAAAACCTCAAAATAGT
TCTCTTCAAAAGAAGAGAGATTCCAAGCAACCCATCTTTCTTCAGTATGTATGTTCTGTA
CATACTTATCGGAGCGCGCCAGTAAGTATCAGGCATATATATCTGTCTGTTAGCAATGAT
TATTACATCATCAGATCAGCATGTGCTATACTCCCTGCAAGAAATATACTGACATGAACA
GGCAGTTCTTGGAGAAGAAAGAGCATTTCTTTAAGTACCTGGGGAATACAGCTCTCAGTG
ATCAGCAGGGAGTTTATTTGAGGACATCAGTCACCTTTGGGGTTGCCATGTACAATGAGA
TTTATAATCATGATACTCTTCGGTGGTAGTTTCAAAAGACACTACTAATACGCAGGAAGC
GTTCCAGCTATTTAATGCTGGCAACTACTGTTTAATGGTCAGTTAAATCTGTGATAATGG
TTGGAAGTGGGTGGGGTTATGAAATTGTAGATGTTTTTAGAAAAACTTGTGAATGAAAAT
GAATCCAAGTGTTTCATGTGAAGATGTTGAGCCATTGCTATCATGCATTCCTGTCTCATG
GCAGAAAATTTTGAAGATTAAAAAATAAAATAATCAAAATGTTTCCTCTTTCTAA

Protein Sequence

>27436 : length: 992
MDGFAGSLDDSISAASTSDVQDRLSALESRVQQQEDEITVLKAALADVLRRLAISEDHVA
SVKKSVSSKGQPSPRAVIPMSCITNGSGANRKPSHTSAVSIAGKETLSSAAKSGTEKKKE
KPQGQREKKEESHSNDQSPQIRASPSPQPSSQPLQIHRQTPESKNATPTKSIKRPSPAEK
SHNSWENSDDSRNKLSKIPSTPKLIPKVTKTADKHKDVIINQAKMSTREKNSQEGEYIKM
FMRGRPITMFIPSDVDNYDDIRTELPPEKLKLEWAYGYRGKDCRANVYLLPTGKIVYFIA
SVVVLFNYEERTQRHYLGHTDCVKCLAIHPDKIRIATGQIAGVDKDGRPLQPHVRVWDSV
TLSTLQIIGLGTFERGVGCLDFSKADSGVHLCIIDDSNEHMLTVWDWQKKAKGAEIKTTN
EVVLAVEFHPTDANTIITCGKSHIFFWTWSGNSLTRKQGIFGKYEKPKFVQCLAFLGNGD
VLTGDSGGVMLIWSKTTVEPTPGKGPKGVYQISKQIKAHDGSVFTLCQMRNGMLLTGGGK
DRKIILWDHDLNPEREIEVPDQYGTIRAVAEGKADQFLVGTSRNFILRGTFNDGFQIEVQ
GHTDELWGLATHPFKDLLLTCAQDRQVCLWNSMEHRLEWTRLVDEPGHCADFHPSGTVVA
IGTHSGRWFVLDAETRDLVSIHTDGNEQLSVMRYSIDGTFLAVGSHDNFIYLYVVSENGR
KYSRYGRCTGHSSYITHLDWSPDNKYIMSNSGDYEILYWDIPNGCKLIRNRSDCKDIDWT
TYTCVLGFQVFGVWPEGSDGTDINALVRSHNRKVIAVADDFCKVHLFQYPCSKAKAPSHK
YSAHSSHVTNVSFTHNDSHLISTGGKDMSIIQWKLVEKLSLPQNETVADTTLTKAPVSST
ESVIQSNTPTPPPSQPLNETAEEESRISSSPTLLENSLEQTVEPSEDHSEEESEEGSGDL
GEPLYEEPCNEISKEQAKATLLEDQQDPSPSS