ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2739

Name

GLO1

Synonym

GLOD1|GLYI|HEL-S-74;glyoxalase I;GLO1;glyoxalase I

Definition

S-D-lactoylglutathione methylglyoxal lyase|aldoketomutase|epididymis secretory protein Li 74|glx I|glyoxalase domain containing 1|ketone-aldehyde mutase|lactoyl glutathione lyase|lactoylglutathione lyase|methylglyoxalase

Position

6p21.3-p21.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Pyruvate metabolism;KEGG PATHWAY;hsa00620

Pathway

methylglyoxal degradation I;BioCyc;PWY-5386

Disease

Renal Cell cancer;FunDO

Disease

Autism, susceptibility to;OMIM

Disease

Tuberculosis;FunDO

Disease

Panic disorder;FunDO

Disease

Prostate cancer;FunDO

Disease

Multiple sclerosis;FunDO

Disease

Hyperglycemia;FunDO

Disease

Autistic disorder;FunDO

External Links

Links to cell senescence gene database

2739

Links to epithelial mesenchymal transition gene database

2739

Links to ovarian cancer gene database

2739

Links to endometrial cancer gene database

2739

Links to iHOP

2739

Sequence Information

Nucleotide Sequence

>2739 : length: 2071
AGCGGTCTCCCGCCCGCGGCGCCATCGCGCCATTCCTAGTTAAGGCGGCACAGGGCCGAG
GCGTAGTGTGGGTGACTCCTCCGTTCCTTGGGTCCCGTCGTCTGTGATACTGCAGCGCAG
CCATGGCAGAACCGCAGCCCCCGTCCGGCGGCCTCACGGACGAGGCCGCCCTCAGTTGCT
GCTCCGACGCGGACCCCAGTACCAAGGATTTTCTATTGCAGCAGACCATGCTACGAGTGA
AGGATCCTAAGAAGTCACTGGATTTTTATACTAGAGTTCTTGGAATGACGCTAATCCAAA
AATGTGATTTTCCCATTATGAAGTTTTCACTCTACTTCTTGGCTTATGAGGATAAAAATG
ACATCCCTAAAGAAAAAGATGAAAAAATAGCCTGGGCGCTCTCCAGAAAAGCTACACTTG
AGCTGACACACAATTGGGGCACTGAAGATGATGAGACCCAGAGTTACCACAATGGCAATT
CAGACCCTCGAGGATTCGGTCATATTGGAATTGCTGTTCCTGATGTATACAGTGCTTGTA
AAAGGTTTGAAGAACTGGGAGTCAAATTTGTGAAGAAACCTGATGATGGTAAAATGAAAG
GCCTGGCATTTATTCAAGATCCTGATGGCTACTGGATTGAAATTTTGAATCCTAACAAAA
TGGCAACCTTAATGTAGTGCTGTGAGAATTCTCCTTTGAGATTTCAGAAGAAAGGAAACA
ATGTGATTCAAGATATTTACATACCAGAAGCATCTAGGACTGATGGATCACTGTCCCGAT
TCAAATTATTCTTCAGTCCATTTCCCCTTCCTATTTCAGCTGTTCCTTTTCACCTAACTG
TTCAGTCATTCTGGTTTTCAAGCAGTGCTTTATCTCATGTCCTTGAATATAGTTGTGTAA
CTTTATTTTTTAGGTAATAATTAGAACAGTTCCCTTCAGAGGCTGCATTTGCCTTCTTCT
GCCACCTAAATATTACTTCCCTTCAAATCTGCCTTTGAATCATCATTTTTAAAAAAAAAT
TAACATGTTTTTGTTGTAGTTATCTTCTGGGGTTTCAATTCCTCAGAAACAACTTTTTTC
ACAACGGAAAGGAAAGAACACTAGTGTTCTTTCAGTAAAGTACAAAGTGTTTATTTTACA
AAAGAGTAGGTACTCTTGAGAGCAATTCAAATCATGCTGACAAGGATACTGATAGAAAAA
GTGATTTCTTCTTATTATAAAGTACATTTAAAGTTCAAGGACTAACCTTATTTATTTGGG
AAAGGGGAGGAGGAAGGAAATGATATGGTACCCAGACACTGGGCTAGGCTGCAACTTTAT
CTCATTTAATACTCCCAGCTGTCATGTGAGAAAGAAAGCAGGCTAGGCATGTGAAATCAC
TTTCATGGATTATTAATGGATTTAAGAGGGCATCAATCAGCTCAACTCAAGATTTCATAA
TCATTTTTAGTATTTAGATTGTGCCTCAAAGTTGTAGTACCTCACAATACCTCCACTGGT
TTCCTGTTGTAAAAACCTTCAGTGAGTTTGACCATTGTGCTCTTGGCTCTTGGGCTGGAG
TACCGTGGTGAGGGAGTAAACACTAGAAGTCTTTAGTACAAAACTGCTCTAGGGACACCT
GGTGATTCCTACACAAGTGATGTTTATATTTCTCATAAAGAGTCTTCCCTATCCCAAGGT
CTTCATGATGCCAGTAGCCATATATGATAAATTATGTTCAGTGATAACTTAGTTATCAGA
AATCAGCTCAGTGGTCTTCCCCGCCATGATTCACATTTGATGAGTTTTTAAAAATCAAAG
TGATTTTGAAAATCTCTAATGGCTCAGAAAATAAAAACATCCAGTTTGTGGATGACTATA
TTTAGATTTCTCTAGACTCTAGTGGAAGACCTTTGGAAAGGCCATGCCAACCGTGCTTGT
ACTGCTAGAAGCACTTTATGTTTCCTTTTTGGGTGAAATGGATTTATGTGAGTGCTTTAA
ACAAATAGCAATACTTATAGACTGAAATAAAATGAAACTTCAAATAAGACTATGTTTAAT
TTGTAAAAAAAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>2739 : length: 184
MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQK
CDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNS
DPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKM
ATLM