ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2737

Name

GLI3

Synonym

ACLS|GCPS|GLI3-190|GLI3FL|PAP-A|PAPA|PAPA1|PAPB|PHS|PPDIV;GLI family zinc finger 3;GLI3;GLI family zinc finger 3

Definition

GLI-Kruppel family member GLI3|glioma-associated oncogene family zinc finger 3|oncogene GLI3|transcriptional activator GLI3|zinc finger protein GLI3

Position

7p13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Hedgehog signaling pathway;PANTHER;P00025

Pathway

Hedgehog signaling events mediated by Gli proteins;PID Curated;200147

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Basal cell carcinoma;KEGG PATHWAY;hsa05217

Pathway

Hedgehog signaling pathway;KEGG PATHWAY;hsa04340

Disease

Acrocallosal syndrome;OMIM

Disease

Polydactyly, preaxial, type IV;OMIM

Disease

talipes equinovarus;GAD

Disease

Congenital abnormality;FunDO

Disease

Greig cephalopolysyndactyly syndrome;OMIM

Disease

Hypothalamic hamartomas, somatic;OMIM

Disease

Pallister-Hall syndrome;OMIM

Disease

DEVELOPMENTAL;GAD

Disease

Polydactyly, postaxial, types A1 and B;OMIM

Disease

Intractable epilepsy;FunDO

External Links

Links to cell senescence gene database

2737

Links to epithelial mesenchymal transition gene database

2737

Links to ovarian cancer gene database

2737

Links to endometrial cancer gene database

2737

Links to iHOP

2737

Sequence Information

Nucleotide Sequence

>2737 : length: 8442
GCAGCACTCCAAGTTTTCCCAACTTCGCCCCCTGCGGCGGCAGGCGTCCTGCTGCTCAGC
GCGTCCCCTCCGAGCCCGAGAGTGGCTGAAAGAAAAGGGACTGGGCGGGGGCCGGGGCGG
AGGAAGAGAGAGTGCGAGGGAGCGAGGAGAGTCCGGCAACATCTGTTAAAACTTGGGGGA
GGAGGAGCGCGGGGAGGAGGAGGAAGAGGAGGAGAGAAGGGAAGGAGGGAGCGCGCGGGA
GGGGAGCGCGGAGCCGAGGGACAACTTTTCCACCCCGGCATTTTTGGTCGAAGAGAGCTG
AAGTAATGAGAAGACATCATGGAGGCCCAGTCCCACAGCTCCACGACCACTGAAAAGAAA
AAAGTTGAGAATTCCATAGTGAAGTGCTCCACTCGAACAGATGTGAGCGAGAAAGCCGTT
GCCTCCAGCACCACTTCTAATGAGGATGAAAGTCCTGGACAGACTTATCACAGAGAGAGA
AGAAACGCAATCACTATGCAGCCACAGAATGTCCAGGGGCTCAGCAAAGTCAGTGAGGAA
CCTTCAACATCGAGTGACGAGAGGGCCTCATTGATCAAGAAAGAGATCCATGGGTCCCTG
CCACACGTGGCGGAGCCCTCTGTGCCGTACCGCGGGACGGTGTTTGCCATGGACCCCAGG
AATGGTTACATGGAGCCCCACTACCACCCTCCTCATCTTTTCCCTGCCTTCCATCCTCCT
GTACCAATTGATGCCAGACATCATGAGGGCCGTTACCATTACGATCCATCTCCGATTCCT
CCATTGCATATGACTTCCGCCTTATCTAGTAGCCCTACGTATCCGGACCTGCCCTTCATT
AGGATCTCCCCACACCGGAACCCCACTGCTGCTTCCGAGTCTCCCTTCAGCCCTCCACAT
CCCTACATTAATCCCTACATGGACTATATCCGCTCCTTGCACAGCAGCCCATCGCTCTCC
ATGATCTCAGCAACCCGTGGGCTGAGCCCTACAGATGCGCCCCATGCAGGAGTCAGCCCA
GCAGAATACTATCATCAGATGGCCCTGCTAACTGGCCAGCGCAGCCCCTATGCAGACATT
ATTCCCTCAGCTGCCACCGCCGGCACGGGGGCCATCCACATGGAATATCTTCATGCTATG
GATAGCACCAGATTCTCCAGCCCCAGGCTGTCAGCCAGGCCGAGCCGAAAACGTACACTG
TCCATATCACCACTCTCCGATCATAGCTTTGACCTTCAGACCATGATAAGGACGTCTCCC
AACTCCTTGGTCACGATTCTCAATAATTCCCGTAGCAGCTCTTCAGCAAGTGGCTCCTAT
GGTCACTTATCTGCAAGTGCAATCAGCCCTGCCTTGAGCTTCACCTACTCTTCCGCGCCC
GTCTCTCTCCACATGCATCAGCAGATCCTAAGCCGACAACAGAGCTTAGGTTCAGCCTTT
GGACACAGCCCTCCACTCATCCACCCTGCCCCAACTTTTCCAACACAGAGGCCTATTCCA
GGGATCCCTACGGTTCTGAACCCCGTCCAGGTCAGCTCCGGCCCTTCTGAGTCCTCACAG
AACAAGCCCACGAGTGAGTCTGCAGTGAGCAGCACTGGTGACCCGATGCACAACAAGAGG
TCCAAGATCAAACCCGATGAAGACCTCCCCAGCCCAGGGGCTCGGGGGCAGCAGGAACAG
CCCGAAGGAACAACCCTTGTCAAGGAGGAAGGGGACAAAGATGAAAGCAAACAGGAGCCT
GAAGTCATCTATGAGACAAACTGCCACTGGGAAGGCTGCGCGAGGGAGTTCGACACCCAA
GAGCAGCTTGTGCACCATATAAATAACGACCATATTCATGGAGAGAAGAAGGAGTTCGTG
TGCAGGTGGCTGGACTGCTCAAGAGAGCAGAAACCCTTCAAAGCCCAGTATATGTTGGTA
GTGCATATGAGAAGACACACGGGCGAGAAGCCTCACAAATGCACTTTTGAAGGTTGCACA
AAGGCCTACTCGAGACTAGAAAACTTGAAAACACACTTGAGATCTCACACTGGAGAGAAA
CCATACGTCTGTGAGCACGAAGGTTGCAACAAGGCTTTCTCAAATGCCTCTGATCGCGCC
AAACACCAAAACAGAACGCATTCCAATGAGAAACCATATGTGTGCAAAATCCCAGGCTGC
ACTAAGCGTTACACAGACCCAAGCTCCCTCCGGAAACATGTGAAGACAGTGCATGGCCCA
GAGGCTCATGTCACCAAGAAGCAGCGAGGGGACATCCATCCTCGGCCGCCACCCCCGAGA
GATTCCGGCAGCCATTCACAGTCCAGGTCGCCTGGCCGACCGACTCAGGGAGCCCTTGGT
GAGCAGCAGGACCTCAGCAACACTACCTCAAAGCGGGAAGAATGCCTCCAGGTGAAAACC
GTCAAGGCAGAGAAGCCAATGACATCTCAGCCAAGCCCTGGTGGTCAGTCTTCATGCAGC
AGCCAACAGTCCCCCATCAGCAACTATTCCAACAGTGGGCTCGAGCTTCCTCTGACCGAT
GGAGGTAGTATAGGAGACCTCAGTGCCATCGATGAAACCCCAATCATGGACTCAACCATT
TCCACTGCAACCACAGCCCTTGCTTTGCAAGCCAGGAGAAACCCGGCAGGGACCAAATGG
ATGGAGCACGTAAAACTAGAAAGGCTAAAACAAGTGAATGGAATGTTTCCGCGACTGAAC
CCCATTCTACCCCCTAAAGCCCCTGCGGTCTCTCCTCTCATAGGAAATGGCACACAGTCC
AACAACACCTGCAGCTTGGGTGGGCCCATGACGCTTCTCCCGGGCAGAAGCGACCTCTCT
GGGGTGGACGTCACTATGCTGAACATGCTCAACAGAAGGGACAGCAGCGCCAGCACCATC
AGCTCGGCCTACCTGAGCAGCCGCCGCTCCTCAGGGATCTCGCCCTGCTTCTCCAGCCGC
CGCTCCAGCGAGGCGTCACAGGCCGAGGGCCGGCCGCAGAACGTGAGCGTGGCCGACTCC
TACGACCCCATCTCCACCGACGCCTCGCGCCGCTCCAGCGAAGCCAGCCAGAGCGACGGC
CTGCCCAGCCTGCTCAGCCTCACGCCCGCCCAGCAGTACCGCCTCAAGGCCAAGTACGCG
GCTGCCACAGGAGGGCCGCCGCCGACGCCCCTGCCCAACATGGAGAGGATGAGCCTGAAG
ACGCGCCTGGCGCTGCTCGGGGATGCCCTCGAGCCTGGCGTGGCCCTGCCTCCAGTTCAT
GCCCCGAGGAGGTGCAGCGACGGGGGAGCCCACGGCTACGGGCGGCGCCACCTGCAGCCG
CACGATGCGCCGGGCCACGGCGTGAGGAGGGCCAGCGACCCGGTGCGGACAGGCTCCGAG
GGCCTGGCCCTGCCTCGTGTGCCGCGCTTCAGCAGCCTCAGCAGCTGCAACCCCCCGGCG
ATGGCCACGTCCGCGGAGAAGCGCAGTCTCGTGCTTCAGAATTACACGCGGCCCGAGGGC
GGCCAGTCCCGAAACTTCCACTCGTCCCCCTGTCCTCCCAGCATCACCGAGAACGTCACC
CTGGAGTCCCTGACCATGGACGCTGATGCCAACCTGAACGATGAGGATTTCCTGCCGGAC
GACGTGGTGCAGTATTTAAATTCCCAGAACCAAGCAGGGTACGAGCAGCACTTCCCCAGC
GCCCTCCCGGACGACAGCAAAGTGCCCCACGGGCCCGGTGACTTTGACGCGCCCGGGCTG
CCAGACAGCCACGCTGGCCAGCAGTTCCATGCCCTCGAGCAGCCCTGCCCCGAGGGCAGC
AAAACCGACCTGCCCATTCAGTGGAACGAAGTCAGCTCCGGAAGCGCCGACCTGTCCTCC
TCCAAGCTCAAGTGTGGGCCGCGGCCCGCTGTGCCGCAGACTCGCGCCTTTGGGTTCTGC
AACGGCATGGTCGTCCACCCGCAGAACCCCTTGAGGAGCGGGCCTGCTGGGGGCTATCAG
ACCCTCGGGGAGAACAGCAACCCCTACGGTGGCCCAGAGCACTTGATGCTCCACAACAGC
CCCGGAAGTGGCACCAGTGGAAACGCCTTCCATGAACAGCCCTGTAAGGCCCCGCAGTAT
GGGAACTGTCTCAACAGGCAGCCAGTGGCCCCTGGTGCACTCGACGGTGCCTGTGGTGCC
GGGATTCAAGCCTCAAAGCTGAAGAGCACCCCCATGCAAGGGAGCGGGGGCCAGCTGAAT
TTCGGCCTGCCGGTAGCGCCAAATGAGTCAGCTGGCAGCATGGTGAATGGCATGCAGAAC
CAGGACCCAGTGGGACAGGGGTACCTGGCTCACCAGCTCCTCGGCGACAGCATGCAGCAC
CCGGGGGCAGGCCGCCCCGGTCAGCAGATGCTTGGGCAGATTAGTGCTACCTCACACATC
AACATCTACCAAGGGCCAGAGAGCTGCCTGCCAGGGGCTCACGGCATGGGCAGCCAGCCG
TCAAGCTTGGCAGTTGTCAGGGGCTACCAGCCATGTGCCAGCTTTGGGGGCAGCAGGCGC
CAGGCTATGCCGAGGGACAGCCTTGCTCTGCAGTCAGGACAGCTCAGTGACACAAGTCAG
ACCTGCAGGGTGAATGGTATCAAGATGGAGATGAAAGGGCAGCCCCATCCGCTGTGCTCT
AATCTGCAGAATTACTCTGGTCAGTTCTATGACCAAACCGTGGGCTTCAGTCAGCAAGAC
ACGAAAGCTGGTTCATTCTCTATTTCAGACGCCAGCTGCCTGCTACAGGGGACCAGCGCC
AAAAACTCTGAGTTACTTTCCCCAGGTGCTAATCAGGTGACAAGCACAGTGGACAGCCTC
GACAGCCATGACCTGGAAGGGGTACAGATTGACTTCGATGCCATCATAGACGATGGGGAC
CACTCCAGCCTGATGTCGGGGGCCCTGAGCCCAAGTATCATTCAGAACCTTTCCCATAGC
TCCTCCCGCCTCACCACGCCTCGGGCGTCCCTCCCATTCCCAGCGCTGTCCATGAGCACC
ACCAACATGGCTATCGGGGACATGAGTTCTTTGCTGACCTCCCTAGCGGAAGAAAGCAAA
TTCCTTGCAGTTATGCAATAGGCTTTAGGAAAAAAAGACTGCAACCAACGGAAATCAATA
GGAGTTGAAGAGATTAAACTGACTTTGTTTTGGCTGTTTTTTTAGTTCTGTATGTATTTT
AGCAATCTCATCTCACCTAACTGAGATGTGTTTCAATTATATTCCTTTTATGGAAAAGGA
CTCTGAAAAACCCTAAAGTATTCTAGGGAGAAACTGTCTTCCATTTCAGTTTTGAATCAG
TATTGTTACACTCAAACCACCCTCTTTTTAAAAAAAAAAAAAAAAACTGTAAGCCCCGCC
CCCTTTTTAGTAAACCGATGTAAATTTGTGATGTGCATATTCTTCTTTCTTTTAGAAGAG
CAGTCAAATTAAAGGATTTGACATGTTTTGCTGTTGCTCAAAGGAAATAGGAGTTGGTGT
GCTTGTGACCAAGGGGTTACACTTCCAGCTTTTAAAATTCTCCTTTACATGTGCTCAGTG
TTTTGTTTTGTGTTTTGGTTTCTGTTTTTTATTTTAATTCCCACATTGGGCACAAGAATC
AGAATATGGATAGCTAGTTTAAGAAACTTTTGTGGGTGCACTGTAGCATAGATGACAGAA
TATTGATGTTCCCCCCATCTCCAATTCAGTTCAGGGCATTCCACAGTTAAACAGAAATGG
GAACGTGGGGCTCTTATAAATGAAATGGGCGCTCACAGTTTTGGTTTTCAGCTCTTCATG
TCTGTAAGTGTGCTTTGGGGGAGGCTATGTCTGTATGGTCGATTCTCAGTTATCACATTT
GCCTCTCCTCCCACTACCTTCATGAACATTCAGTGCTGTTTCGCACTGCAGTTAGAGAGA
AGGGACGGACAGTTGGTGACACTCAGCCACATTGCTACTTTTATCTGTTCTGGTAAGAAG
TTAGATAGATGGTAGATTGAAGCAATTGGGTAGAATTAGTTGGGGGAATATTTATGAGTT
GCTGTGTTTGTTGATTAGTTCCATCTCTTTCCCATTTTAACTGAGAATTGATTATATATA
GCTCTAAGTATATAGGTATTTAAACAACCCCACAAGCGGCTGTATCAGTAACATTTATTA
ATTCCACTATAGTGAGGGAGGATTTCCATTCTAAATACCTTATTTTGAGGGATTTATAAA
ACTTAGTTGTAAAAGAGAAAGCCCACATAGTGGGAATAAATTGCTTCAGCCATTTTTAGT
ATTTGAGAGCACTAGGGAAGATGTTTAGTAGCTGTGTGGATGCCTTTTTTCACACCCTGT
CTATTGAATGCTGCATCCATTCACGAAGTTAAATGTTACATGCAGTTAGTCCTTAATGTG
GACTGGATCTGTACTTTTGTTTTGGATTAAAACATTTAAAGATTTTTGAAGTGCAGCTAC
TCCCCACGTGCATTTGATACACATAAAAGTCATACTGTGTGTGCACAAAGAGTACATGGA
TTTTCCAGCATATTGCTTTAAAAAATTATATAAACTGTTAAAATATTAACACCTCAGGCT
ACCTGCTGTATTCTGTCCCATTGACCCCTGGAATTGGATTTACTGCAAGTGATTGATAAT
TCAATTATGTGGCTTTTCCCCTTTAATCTTGCCATTTAAATTACAGTAGAAAGACAAAAT
CAAGTAAAATAAAGTGTTAGATAATAGAAAGAGTGTTAAGACCAGCCCACTTTTCTCATG
TTTATGTTCTTTCATTTGGACCAAGAATCTCCGCATGGAGGTTGATTTGCCACTGGGGAC
TTTGGCTAAGACTATTAGGTTTGCTTTCAACTAGATGTTCCTGAGACAAGCAGAGGGACA
CTGCAATTCCCCTTCCATGCCTGCTGTTCTCCCCCATGTAAGTCTTCTTTGAAATTAACG
GATGTGTCTCCTTTGGAACAGCCCCATAACAAAAGAGAACTACTGATCTGAGCATAGGAA
AGTAGAGGCTCTACCACTTTTCAGTTGAAAAAGCAAGACTTTCTCTGTGTTTCTGAAACA
AGGCATAATGTTGTCACAGAATCAGAGATCCAGTCTCACTTTTCCACAAATCTCCAAATC
TCCAGTCTTATCTTGTGTGCTCTAATGGTTTGGTTCAATCCCTTTCCAACTCTTGTTTTC
AAAGCATGGGGCCTGAGTGTTCTCCACTCCTCCTAAGAAAGGAGCTTGGGTGGAAGGGAC
CATGCTGACCTCCTCCATCAGAGGGCTCTTCCAGTAGTATTCTCGGATGCAACCTCCATT
TCTCAGTTACCATTATTTCCTGTATCAGCTTTGTCCTTCCTGGAGGGATGCACAGTGATC
CGGCCCACCACTGTTGTTGTCTTGTGCTTCTGCTCTTTCCTATGGTTTCAGGTTATTTTC
TGGGTTTCCCCTATTCTTCTTTTATTTCTTTTTTTTTTTATATTTGCTTTCCTTTCTACT
GCTTTTAGATTTGCAGGAGATGCAAGTTTCAGCTCAATGTTTGGCTTCTCTCAATATGGA
AATTTCAGAAGGACAGAGGAGAGGAGGGAGGAAGAAGAAAGTATACTCCTCCAGAATTTC
AGTGATCTGTTGTGGCAGTCCAGTGGAAGGAAGGTCTTTTGAGGTCACTTAGAAGCATCT
TTTTGGGACATCCTTTTGGGATCTCTGTAGGCTAGGCATCTCATATCTTGAGACTCACCC
CCAGCCTCCAAGCCTCTCTCCATTTCTCTAACCTATGCATTTTAGAGCGAGAGGACCGCC
TCACTAGTGTCACCATCCTGCCTTTTCTAAAACATGCAGGCTCACACATTCTACTCCTGC
TTAATGTCTGTGTTAAACGTTTTCTAACCATTTTTGTTTTATTTTTCTGAAAAAGTTAAC
CCCTCCCAACTCCTCACACATTGGCTCTTCCTCTTGAGCCACAAAGTTTTGATTCTTGCG
ATGTATGTGCCTTATTTTATGTTAATCTTGTCAATGAGAGGGACCAGTTGGTGTTGCCCA
ATCAGCACTCCAAGGCTGTGTGTGCACCAGCCAGAGAGCGCACGGTGGTAGCAGAGTCGA
GGCTGTCTTGTATCCTGGTTTCATGTGTTGTTTTGAACTGATAGGAGGATGTTCTCTTCT
GACAAGTTACCCTTGTGTATCCTGCAGACATGTAAAATAAAATACAAGTTCATTTTTTTC
ACCTTTTTTAGATTTTTTTAAAAAATAAAATGTGTAATCCTTTTTTTAAAAGAAACACAT
GTAAATACATTTAAGTATTGTAGGCATAGCGTTCAGATGTGACTGGCCCAGGCGTTCCTC
GGACAAGCCTGCATTCCCCGTGATCACGCCCACCTCAAGCCCAGGGGCTGCAGCCCAGCC
ACAGATGAACTCTACCTTTGCTTTCAGAACCACTTAGTCCTTTTGTAACAAAGAAAAAAA
AATGTTTCTTACAATGTCAATAAAAAATTCTTTGTATGGAAA

Protein Sequence

>2737 : length: 1580
MEAQSHSSTTTEKKKVENSIVKCSTRTDVSEKAVASSTTSNEDESPGQTYHRERRNAITM
QPQNVQGLSKVSEEPSTSSDERASLIKKEIHGSLPHVAEPSVPYRGTVFAMDPRNGYMEP
HYHPPHLFPAFHPPVPIDARHHEGRYHYDPSPIPPLHMTSALSSSPTYPDLPFIRISPHR
NPTAASESPFSPPHPYINPYMDYIRSLHSSPSLSMISATRGLSPTDAPHAGVSPAEYYHQ
MALLTGQRSPYADIIPSAATAGTGAIHMEYLHAMDSTRFSSPRLSARPSRKRTLSISPLS
DHSFDLQTMIRTSPNSLVTILNNSRSSSSASGSYGHLSASAISPALSFTYSSAPVSLHMH
QQILSRQQSLGSAFGHSPPLIHPAPTFPTQRPIPGIPTVLNPVQVSSGPSESSQNKPTSE
SAVSSTGDPMHNKRSKIKPDEDLPSPGARGQQEQPEGTTLVKEEGDKDESKQEPEVIYET
NCHWEGCAREFDTQEQLVHHINNDHIHGEKKEFVCRWLDCSREQKPFKAQYMLVVHMRRH
TGEKPHKCTFEGCTKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRT
HSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRGDIHPRPPPPRDSGSHS
QSRSPGRPTQGALGEQQDLSNTTSKREECLQVKTVKAEKPMTSQPSPGGQSSCSSQQSPI
SNYSNSGLELPLTDGGSIGDLSAIDETPIMDSTISTATTALALQARRNPAGTKWMEHVKL
ERLKQVNGMFPRLNPILPPKAPAVSPLIGNGTQSNNTCSLGGPMTLLPGRSDLSGVDVTM
LNMLNRRDSSASTISSAYLSSRRSSGISPCFSSRRSSEASQAEGRPQNVSVADSYDPIST
DASRRSSEASQSDGLPSLLSLTPAQQYRLKAKYAAATGGPPPTPLPNMERMSLKTRLALL
GDALEPGVALPPVHAPRRCSDGGAHGYGRRHLQPHDAPGHGVRRASDPVRTGSEGLALPR
VPRFSSLSSCNPPAMATSAEKRSLVLQNYTRPEGGQSRNFHSSPCPPSITENVTLESLTM
DADANLNDEDFLPDDVVQYLNSQNQAGYEQHFPSALPDDSKVPHGPGDFDAPGLPDSHAG
QQFHALEQPCPEGSKTDLPIQWNEVSSGSADLSSSKLKCGPRPAVPQTRAFGFCNGMVVH
PQNPLRSGPAGGYQTLGENSNPYGGPEHLMLHNSPGSGTSGNAFHEQPCKAPQYGNCLNR
QPVAPGALDGACGAGIQASKLKSTPMQGSGGQLNFGLPVAPNESAGSMVNGMQNQDPVGQ
GYLAHQLLGDSMQHPGAGRPGQQMLGQISATSHINIYQGPESCLPGAHGMGSQPSSLAVV
RGYQPCASFGGSRRQAMPRDSLALQSGQLSDTSQTCRVNGIKMEMKGQPHPLCSNLQNYS
GQFYDQTVGFSQQDTKAGSFSISDASCLLQGTSAKNSELLSPGANQVTSTVDSLDSHDLE
GVQIDFDAIIDDGDHSSLMSGALSPSIIQNLSHSSSRLTTPRASLPFPALSMSTTNMAIG
DMSSLLTSLAEESKFLAVMQ