ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2735

Name

GLI1

Synonym

GLI;GLI family zinc finger 1;GLI1;GLI family zinc finger 1

Definition

GLI-Kruppel family member GLI1|glioma-associated oncogene 1|glioma-associated oncogene homolog 1 (zinc finger protein)|oncogene GLI|zinc finger protein GLI1

Position

12q13.2-q13.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Hedgehog signaling pathway;PANTHER;P00025

Pathway

Hedgehog signaling events mediated by Gli proteins;PID Curated;200147

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Basal cell carcinoma;KEGG PATHWAY;hsa05217

Pathway

Hedgehog signaling pathway;KEGG PATHWAY;hsa04340

Disease

Cancer;FunDO

External Links

Links to cell senescence gene database

2735

Links to epithelial mesenchymal transition gene database

2735

Links to ovarian cancer gene database

2735

Links to endometrial cancer gene database

2735

Links to iHOP

2735

Sequence Information

Nucleotide Sequence

>2735 : length: 3703
TCAGTCTGTGTATCTCTGTCTCAGGGAACCGTGGGTCTTTGTCTCCGCCTCTCCCATATA
TTAGAAATATCTTACTTTCATGCGGTTAAGTTTAAGAGGCTGGAGGGATGGCTAGCTGGA
GGTCTGCGTTGTAGAGAGGTAACCCCAGTGTCCCCACACCCTCCTCTGAGACGCCATGTT
CAACTCGATGACCCCACCACCAATCAGTAGCTATGGCGAGCCCTGCTGTCTCCGGCCCCT
CCCCAGTCAGGGGGCCCCCAGTGTGGGGACAGAAGGACTGTCTGGCCCGCCCTTCTGCCA
CCAAGCTAACCTCATGTCCGGCCCCCACAGTTATGGGCCAGCCAGAGAGACCAACAGCTG
CACCGAGGGCCCACTCTTTTCTTCTCCCCGGAGTGCAGTCAAGTTGACCAAGAAGCGGGC
ACTGTCCATCTCACCTCTGTCGGATGCCAGCCTGGACCTGCAGACGGTTATCCGCACCTC
ACCCAGCTCCCTCGTAGCTTTCATCAACTCGCGATGCACATCTCCAGGAGGCTCCTACGG
TCATCTCTCCATTGGCACCATGAGCCCATCTCTGGGATTCCCAGCCCAGATGAATCACCA
AAAAGGGCCCTCGCCTTCCTTTGGGGTCCAGCCTTGTGGTCCCCATGACTCTGCCCGGGG
TGGGATGATCCCACATCCTCAGTCCCGGGGACCCTTCCCAACTTGCCAGCTGAAGTCTGA
GCTGGACATGCTGGTTGGCAAGTGCCGGGAGGAACCCTTGGAAGGTGATATGTCCAGCCC
CAACTCCACAGGCATACAGGATCCCCTGTTGGGGATGCTGGATGGGCGGGAGGACCTCGA
GAGAGAGGAGAAGCGTGAGCCTGAATCTGTGTATGAAACTGACTGCCGTTGGGATGGCTG
CAGCCAGGAATTTGACTCCCAAGAGCAGCTGGTGCACCACATCAACAGCGAGCACATCCA
CGGGGAGCGGAAGGAGTTCGTGTGCCACTGGGGGGGCTGCTCCAGGGAGCTGAGGCCCTT
CAAAGCCCAGTACATGCTGGTGGTTCACATGCGCAGACACACTGGCGAGAAGCCACACAA
GTGCACGTTTGAAGGGTGCCGGAAGTCATACTCACGCCTCGAAAACCTGAAGACGCACCT
GCGGTCACACACGGGTGAGAAGCCATACATGTGTGAGCACGAGGGCTGCAGTAAAGCCTT
CAGCAATGCCAGTGACCGAGCCAAGCACCAGAATCGGACCCATTCCAATGAGAAGCCGTA
TGTATGTAAGCTCCCTGGCTGCACCAAACGCTATACAGATCCTAGCTCGCTGCGAAAACA
TGTCAAGACAGTGCATGGTCCTGACGCCCATGTGACCAAACGGCACCGTGGGGATGGCCC
CCTGCCTCGGGCACCATCCATTTCTACAGTGGAGCCCAAGAGGGAGCGGGAAGGAGGTCC
CATCAGGGAGGAAAGCAGACTGACTGTGCCAGAGGGTGCCATGAAGCCACAGCCAAGCCC
TGGGGCCCAGTCATCCTGCAGCAGTGACCACTCCCCGGCAGGGAGTGCAGCCAATACAGA
CAGTGGTGTGGAAATGACTGGCAATGCAGGGGGCAGCACTGAAGACCTCTCCAGCTTGGA
CGAGGGACCTTGCATTGCTGGCACTGGTCTGTCCACTCTTCGCCGCCTTGAGAACCTCAG
GCTGGACCAGCTACATCAACTCCGGCCAATAGGGACCCGGGGTCTCAAACTGCCCAGCTT
GTCCCACACCGGTACCACTGTGTCCCGCCGCGTGGGCCCCCCAGTCTCTCTTGAACGCCG
CAGCAGCAGCTCCAGCAGCATCAGCTCTGCCTATACTGTCAGCCGCCGCTCCTCCCTGGC
CTCTCCTTTCCCCCCTGGCTCCCCACCAGAGAATGGAGCATCCTCCCTGCCTGGCCTTAT
GCCTGCCCAGCACTACCTGCTTCGGGCAAGATATGCTTCAGCCAGAGGGGGTGGTACTTC
GCCCACTGCAGCATCCAGCCTGGATCGGATAGGTGGTCTTCCCATGCCTCCTTGGAGAAG
CCGAGCCGAGTATCCAGGATACAACCCCAATGCAGGGGTCACCCGGAGGGCCAGTGACCC
AGCCCAGGCTGCTGACCGTCCTGCTCCAGCTAGAGTCCAGAGGTTCAAGAGCCTGGGCTG
TGTCCATACCCCACCCACTGTGGCAGGGGGAGGACAGAACTTTGATCCTTACCTCCCAAC
CTCTGTCTACTCACCACAGCCCCCCAGCATCACTGAGAATGCTGCCATGGATGCTAGAGG
GCTACAGGAAGAGCCAGAAGTTGGGACCTCCATGGTGGGCAGTGGTCTGAACCCCTATAT
GGACTTCCCACCTACTGATACTCTGGGATATGGGGGACCTGAAGGGGCAGCAGCTGAGCC
TTATGGAGCGAGGGGTCCAGGCTCTCTGCCTCTTGGGCCTGGTCCACCCACCAACTATGG
CCCCAACCCCTGTCCCCAGCAGGCCTCATATCCTGACCCCACCCAAGAAACATGGGGTGA
GTTCCCTTCCCACTCTGGGCTGTACCCAGGCCCCAAGGCTCTAGGTGGAACCTACAGCCA
GTGTCCTCGACTTGAACATTATGGACAAGTGCAAGTCAAGCCAGAACAGGGGTGCCCAGT
GGGGTCTGACTCCACAGGACTGGCACCCTGCCTCAATGCCCACCCCAGTGAGGGGCCCCC
ACATCCACAGCCTCTCTTTTCCCATTACCCCCAGCCCTCTCCTCCCCAATATCTCCAGTC
AGGCCCCTATACCCAGCCACCCCCTGATTATCTTCCTTCAGAACCCAGGCCTTGCCTGGA
CTTTGATTCCCCCACCCATTCCACAGGGCAGCTCAAGGCTCAGCTTGTGTGTAATTATGT
TCAATCTCAACAGGAGCTACTGTGGGAGGGTGGGGGCAGGGAAGATGCCCCCGCCCAGGA
ACCTTCCTACCAGAGTCCCAAGTTTCTGGGGGGTTCCCAGGTTAGCCCAAGCCGTGCTAA
AGCTCCAGTGAACACATATGGACCTGGCTTTGGACCCAACTTGCCCAATCACAAGTCAGG
TTCCTATCCCACCCCTTCACCATGCCATGAAAATTTTGTAGTGGGGGCAAATAGGGCTTC
ACATAGGGCAGCAGCACCACCTCGACTTCTGCCCCCATTGCCCACTTGCTATGGGCCTCT
CAAAGTGGGAGGCACAAACCCCAGCTGTGGTCATCCTGAGGTGGGCAGGCTAGGAGGGGG
TCCTGCCTTGTACCCTCCTCCCGAAGGACAGGTATGTAACCCCCTGGACTCTCTTGATCT
TGACAACACTCAGCTGGACTTTGTGGCTATTCTGGATGAGCCCCAGGGGCTGAGTCCTCC
TCCTTCCCATGATCAGCGGGGCAGCTCTGGACATACCCCACCTCCCTCTGGGCCCCCCAA
CATGGCTGTGGGCAACATGAGTGTCTTACTGAGATCCCTACCTGGGGAAACAGAATTCCT
CAACTCTAGTGCCTAAAGAGTAGGGAATCTCATCCATCACAGATCGCATTTCCTAAGGGG
TTTCTATCCTTCCAGAAAAATTGGGGGAGCTGCAGTCCCATGCACAAGATGCCCCAGGGA
TGGGAGGTATGGGCTGGGGGCTATGTATAGTCTGTATACGTTTTGAGGAGAAATTTGATA
ATGACACTGTTTCCTGATAATAAAGGAACTGCATCAGAAAAAA

Protein Sequence

>2735 : length: 1106
MFNSMTPPPISSYGEPCCLRPLPSQGAPSVGTEGLSGPPFCHQANLMSGPHSYGPARETN
SCTEGPLFSSPRSAVKLTKKRALSISPLSDASLDLQTVIRTSPSSLVAFINSRCTSPGGS
YGHLSIGTMSPSLGFPAQMNHQKGPSPSFGVQPCGPHDSARGGMIPHPQSRGPFPTCQLK
SELDMLVGKCREEPLEGDMSSPNSTGIQDPLLGMLDGREDLEREEKREPESVYETDCRWD
GCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKP
HKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSNEK
PYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGDGPLPRAPSISTVEPKREREG
GPIREESRLTVPEGAMKPQPSPGAQSSCSSDHSPAGSAANTDSGVEMTGNAGGSTEDLSS
LDEGPCIAGTGLSTLRRLENLRLDQLHQLRPIGTRGLKLPSLSHTGTTVSRRVGPPVSLE
RRSSSSSSISSAYTVSRRSSLASPFPPGSPPENGASSLPGLMPAQHYLLRARYASARGGG
TSPTAASSLDRIGGLPMPPWRSRAEYPGYNPNAGVTRRASDPAQAADRPAPARVQRFKSL
GCVHTPPTVAGGGQNFDPYLPTSVYSPQPPSITENAAMDARGLQEEPEVGTSMVGSGLNP
YMDFPPTDTLGYGGPEGAAAEPYGARGPGSLPLGPGPPTNYGPNPCPQQASYPDPTQETW
GEFPSHSGLYPGPKALGGTYSQCPRLEHYGQVQVKPEQGCPVGSDSTGLAPCLNAHPSEG
PPHPQPLFSHYPQPSPPQYLQSGPYTQPPPDYLPSEPRPCLDFDSPTHSTGQLKAQLVCN
YVQSQQELLWEGGGREDAPAQEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHK
SGSYPTPSPCHENFVVGANRASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLG
GGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQRGSSGHTPPPSGP
PNMAVGNMSVLLRSLPGETEFLNSSA