ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

27257

Name

LSM1

Synonym

CASM|YJL124C;LSM1, U6 small nuclear RNA associated;LSM1;LSM1, U6 small nuclear RNA associated

Definition

LSM1 homolog, U6 small nuclear RNA associated|U6 snRNA-associated Sm-like protein LSm1|cancer-associated Sm-like protein|small nuclear ribonuclear CaSm

Position

8p11.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Metabolism of RNA;Reactome;REACT:21257

Pathway

RNA degradation;KEGG PATHWAY;hsa03018

Disease

Breast cancer;FunDO

Disease

Prostate cancer;FunDO

External Links

Links to cell senescence gene database

27257

Links to epithelial mesenchymal transition gene database

27257

Links to ovarian cancer gene database

27257

Links to endometrial cancer gene database

27257

Links to iHOP

27257

Sequence Information

Nucleotide Sequence

>27257 : length: 1161
TCTGCTGCCGAACCCCGAAAGCTGAGGGACGGAGGTCAGTGACTCTGGGGTCTCGGGAAC
CCGGAGACGAAGGAAGACACCGTGTTCCTTAAGAGGGAGTATACGTTTCCTCGCCATTTA
TCCAATGGAGTTTCCTCTTACCTACTTAACAGGAACAGGGAAAGGGTGTCCCCCAACGGT
ACGGCTGCCCCGCCTCTTCCTGGGGGCCCACACGTGTTACAGGAAGTGGGTAAGGGTAAT
ATGGAGGAGCTTCCGGCAGCCCCCGGCGGCTGAAAGCCGGGGCAGAAGTGCTGGTCTCGG
TCGGGATTCCGGGCTTGGTCCCACCGAGGCGGCGACTGCGGTAGGAGGGAAGAGGTTTTG
GACGCGCTGGCCTCCCGCCGCTGTGCATTGCAGCATTATTTCAGTTCAAAATGAACTATA
TGCCTGGCACCGCCAGCCTCATCGAGGACATTGACAAAAAGCACTTGGTTCTGCTTCGAG
ATGGAAGGACACTTATAGGCTTTTTAAGAAGCATTGATCAATTTGCAAACTTAGTGCTAC
ATCAGACTGTGGAGCGTATTCATGTGGGCAAAAAATACGGTGATATTCCTCGAGGGATTT
TTGTGGTCAGAGGAGAAAATGTGGTCCTACTAGGAGAAATAGACTTGGAAAAGGAGAGTG
ACACACCCCTCCAGCAAGTATCCATTGAAGAAATTCTAGAAGAACAAAGGGTGGAACAGC
AGACCAAGCTGGAAGCAGAGAAGTTGAAAGTGCAGGCCCTGAAGGACCGAGGTCTTTCCA
TTCCTCGAGCAGATACTCTTGATGAGTACTAATCTTTTGCCCAGAGGCTGTTGGCTCTTG
AAGAGTAGGGGCTGTCACTGAGTGAAAGTGACATCCTGGCCACCTCACGCATTTGATCAC
AGACTGTAGAGTTTTGAAAAGTCACTTTTATTTTTAATTATTTTACATATGCAACATGAA
GAAATCGTGTAGGTGGGTTTTTTTTTTAATAACAAAATCACTGTTTAAAGAAACAGTGGC
ATAGACTCCTTCACACATCACTGTGGCACCAGCAACTACTTCTTTATATTGTTCTTCATA
TCCCAAATTAGAGTTTACAGGGACAGTCTTCATTTACTTGTAAATAAAATATGAATCTCA
AAAGTGTCATGTTATTTCCAA

Protein Sequence

>27257 : length: 133
MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIP
RGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDR
GLSIPRADTLDEY