ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

27163

Name

NAAA

Synonym

ASAHL|PLT;N-acylethanolamine acid amidase;NAAA;N-acylethanolamine acid amidase

Definition

ASAH-like protein|N-acylethanolamine-hydrolyzing acid amidase|acid ceramidase-like protein

Position

4q21.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

27163

Links to epithelial mesenchymal transition gene database

27163

Links to ovarian cancer gene database

27163

Links to endometrial cancer gene database

27163

Links to iHOP

27163

Sequence Information

Nucleotide Sequence

>27163 : length: 1880
ACGGCTTACCCGGGCTCCGACAGCGGCTGCAGGTCTCCAAGTTGCGGCCGCTGGAGCCCG
AGCCATGCGGACCGCGGACCGGGAGGCGCGCCCGGGGCTTCCGTCCCTGCTGCTGCTGCT
GCTGGCCGGGGCCGGGCTGTCAGCCGCCTCGCCCCCAGCAGCGCCGCGCTTCAACGTGAG
CCTGGACTCGGTCCCCGAGCTGCGCTGGCTGCCCGTGCTGCGGCACTACGACTTGGACTT
GGTGCGCGCCGCGATGGCGCAAGTCATCGGGGACAGAGTCCCCAAGTGGGTGCACGTGTT
AATCGGAAAAGTGGTCCTGGAGCTGGAGCGCTTCCTGCCCCAGCCCTTCACCGGCGAGAT
CCGCGGCATGTGTGACTTCATGAACCTCAGCCTGGCGGACTGCCTTCTGGTCAACCTGGC
CTACGAGTCCTCCGTGTTCTGCACCAGTATTGTGGCTCAAGACTCCAGAGGCCACATTTA
CCATGGTCGGAATTTGGATTATCCTTTTGGGAATGTCTTACGCAAGCTGACAGTGGATGT
GCAATTCTTAAAGAATGGGCAGATTGCATTCACAGGAACTACTTTTATTGGCTATGTAGG
ATTATGGACTGGCCAGAGCCCACACAAGTTTACAGTTTCTGGTGATGAACGAGATAAAGG
CTGGTGGTGGGAGAATGCTATCGCTGCCCTGTTTCGGAGACACATTCCCGTCAGCTGGCT
GATCCGCGCTACCCTGAGTGAGTCGGAAAACTTCGAAGCAGCTGTTGGCAAGTTGGCCAA
GACTCCCCTTATTGCTGATGTTTATTACATTGTTGGTGGCACGTCCCCCCGGGAGGGGGT
GGTCATCACGAGGAACAGAGATGGCCCAGCAGACATTTGGCCTCTAGATCCTTTGAATGG
AGCGTGGTTCCGAGTTGAGACAAATTACGACCACTGGAAGCCAGCACCCAAGGAAGATGA
CCGGAGAACATCTGCCATCAAGGCCCTTAATGCTACAGGACAAGCAAACCTCAGCCTGGA
GGCACTTTTCCAGATTTTGTCGGTGGTTCCAGTTTATAACAACTTCACAATTTATACTAC
GGTAATGAGCGCCGGTAGCCCAGACAAGTACATGACTAGGATCAGAAACCCGAGTAGAAA
GTAAGTCAGCAGAAGAGCGAGTTCGCCCGTGCTGTGAAAGATGATTTTTTAAAAAATGAA
ATTCTTGAAGAGCTGCACCTTAAAAAATAAGACAAAGTGAAAGTATTGTATTATGTTACA
AACAATGCAGGCTCCTTCCTCATTTAACTTTACAACCTTGCGAAGTGGGTCCAGGAGATT
TGGAGTTTGTGGTAAAGCCAGTAATGGGCATTGTCCTGCATTCCCTTCCCTTCATGGTTT
GCCTCGATCCTCTCTAAGCTTCTATCCTGGCCTGAATAACTCAAAGATAATTGGTCTCAG
AGATCAAGCCATATCCTCAGGCCTTATTTCCATCTTCTCATGATTCTGCCATCATACCTT
TGCTTCTCCGCTAATGAAATGAGCTGGCAAGACCTCTGTTCATTGTGAAGTGCTTCTGAA
AGAGCCTAAGAAAAAAGGCTCATCTGAAAGAAATGGAGAACTCTATTTCGAACCAAGCCT
GTTTGAATGTGTGTTAGTCTGATCTTTGATCATGTGTTTCCATGTAATGGGAGTCTCGTT
TTTTATAATGTTTCTAACGTTTTATTGAAAAACCTATGGCCCTCCTTCTTTCTCAATAGC
TACTTTCTTACTGCTTTTTGAAAATAATATGCAACCAAATTATTTCTTAATGTCACATAA
TTAAGTAATAAAATGTCAAAAGAAATGTTGGCAAGGAGAATAAAAAAATTTCCAAGAAAC
TTAAAAAAAAAAAAAAAAAA

Protein Sequence

>27163 : length: 359
MRTADREARPGLPSLLLLLLAGAGLSAASPPAAPRFNVSLDSVPELRWLPVLRHYDLDLV
RAAMAQVIGDRVPKWVHVLIGKVVLELERFLPQPFTGEIRGMCDFMNLSLADCLLVNLAY
ESSVFCTSIVAQDSRGHIYHGRNLDYPFGNVLRKLTVDVQFLKNGQIAFTGTTFIGYVGL
WTGQSPHKFTVSGDERDKGWWWENAIAALFRRHIPVSWLIRATLSESENFEAAVGKLAKT
PLIADVYYIVGGTSPREGVVITRNRDGPADIWPLDPLNGAWFRVETNYDHWKPAPKEDDR
RTSAIKALNATGQANLSLEALFQILSVVPVYNNFTIYTTVMSAGSPDKYMTRIRNPSRK