ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

27043

Name

PELP1

Synonym

MNAR|P160;proline, glutamate and leucine rich protein 1;PELP1;proline, glutamate and leucine rich protein 1

Definition

modulator of non-genomic activity of estrogen receptor|proline and glutamic acid rich nuclear protein|proline-, glutamic acid- and leucine-rich protein 1|transcription factor HMX3

Position

17p13.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Coregulation of Androgen receptor activity;PID Curated;200038

Pathway

pelp1 modulation of estrogen receptor activity;PID BioCarta;100076

Pathway

Nongenotropic Androgen signaling;PID Curated;200145

Pathway

Plasma membrane estrogen receptor signaling;PID Curated;200029

Disease

Endometrial cancer;FunDO

Disease

Neoplasm metastasis;FunDO

Disease

Prostate cancer;FunDO

External Links

Links to cell senescence gene database

27043

Links to epithelial mesenchymal transition gene database

27043

Links to ovarian cancer gene database

27043

Links to endometrial cancer gene database

27043

Links to iHOP

27043

Sequence Information

Nucleotide Sequence

>27043 : length: 3688
ACAGGCAGCCTCATCCGCCATCACTCCGGGAACCGAGCACCCCGCTGCCTCGGCGCCCAG
GCTGCTCTCTCCGCGCATGCTCCTTCCCAGCTTGAGCCCGCGAGTCCAGCCTGCCTTCAC
TCAGTGCGCAAGACCGCAGCCCCCTCCCCACGCCCCCTCCCCAGTAGGCGGCCGTCGCGG
TGTGTTTGCGTCATCGCGCCACGCCACCACTGGAACCCGGGGGAAGATGGCGGCAGCCGT
TCTGAGTGGGCCCTCTGCGGGCTCCGCGGCTGGGGTTCCTGGCGGGACCGGGGGTCTCTC
GGCAGTGAGCTCGGGCCCGCGGCTCCGCCTGCTGCTGCTGGAGAGTGTTTCTGGTTTGCT
GCAACCTCGAACGGGGTCTGCCGTTGCTCCGGTGCATCCCCCAAACCGCTCGGCCCCACA
TTTGCCCGGGCTCATGTGCCTATTGCGGCTGCATGGGTCGGTGGGCGGGGCCCAGAACCT
TTCAGCTCTTGGGGCATTGGTGAGTCTCAGTAATGCACGTCTCAGTTCCATCAAAACTCG
GTTTGAGGGCCTGTGTCTGCTGTCCCTGCTGGTAGGGGAGAGCCCCACAGAGCTATTCCA
GCAGCACTGTGTGTCTTGGCTTCGGAGCATTCAGCAGGTGTTACAGACCCAGGACCCGCC
TGCCACAATGGAGCTGGCCGTGGCTGTCCTGAGGGACCTCCTCCGATATGCAGCCCAGCT
GCCTGCACTGTTCCGGGACATCTCCATGAACCACCTCCCTGGCCTTCTCACCTCCCTGCT
GGGCCTCAGGCCAGAGTGTGAGCAGTCAGCATTGGAAGGAATGAAGGCTTGTATGACCTA
TTTCCCTCGGGCTTGTGGTTCTCTCAAAGGCAAGCTGGCCTCATTTTTTCTGTCTAGGGT
GGATGCCTTGAGCCCTCAGCTCCAACAGTTGGCCTGTGAGTGTTATTCCCGGCTGCCCTC
TTTAGGGGCTGGCTTTTCCCAAGGCCTGAAGCACACCGAGAGCTGGGAGCAGGAGCTACA
CAGTCTGCTGGCCTCACTGCACACCCTGCTGGGGGCCCTGTACGAGGGAGCAGAGACTGC
TCCTGTGCAGAATGAAGGCCCTGGGGTGGAGATGCTGCTGTCCTCAGAAGATGGTGATGC
CCATGTCCTTCTCCAGCTTCGGCAGAGGTTTTCGGGACTGGCCCGCTGCCTAGGGCTCAT
GCTCAGCTCTGAGTTTGGAGCTCCCGTGTCCGTCCCTGTGCAGGAAATCCTGGATTTCAT
CTGCCGGACCCTCAGCGTCAGTAGCAAGAATATTAGCTTGCATGGAGATGGTCCCCTGCG
GCTGCTGCTGCTGCCCTCTATCCACCTTGAGGCCTTGGACCTGCTGTCTGCACTCATCCT
CGCGTGTGGAAGCCGGCTCTTGCGCTTTGGGATCCTGATCGGCCGCCTGCTTCCCCAGGT
CCTCAATTCCTGGAGCATCGGTAGAGATTCCCTCTCTCCAGGCCAGGAGAGGCCTTACAG
CACGGTTCGGACCAAGGTGTATGCGATATTAGAGCTGTGGGTGCAGGTTTGTGGGGCCTC
GGCGGGAATGCTTCAGGGAGGAGCCTCTGGAGAGGCCCTGCTCACCCACCTGCTCAGCGA
CATCTCCCCGCCAGCTGATGCCCTTAAGCTGCGTAGCCCGCGGGGGAGCCCTGATGGGAG
TTTGCAGACTGGGAAGCCTAGCGCCCCCAAGAAGCTAAAGCTGGATGTGGGGGAAGCTAT
GGCCCCGCCAAGCCACCGGAAAGGGGATAGCAATGCCAACAGCGACGTGTGTGCGGCTGC
ACTCAGAGGCCTCAGCCGGACCATCCTCATGTGTGGGCCTCTCATCAAGGAGGAGACTCA
CAGGAGACTGCATGACCTGGTCCTCCCCCTGGTCATGGGTGTACAGCAGGGTGAGGTCCT
AGGCAGCTCCCCGTACACGAGCTCCCGCTGCCGCCGTGAACTCTACTGCCTGCTGCTGGC
GCTGCTGCTGGCCCCGTCTCCTCGCTGCCCACCTCCTCTTGCCTGTGCCCTGCAAGCCTT
CTCCCTCGGCCAGCGAGAAGATAGCCTTGAGGTCTCCTCTTTCTGCTCAGAAGCACTGGT
GACCTGTGCTGCTCTGACCCACCCCCGGGTTCCTCCCCTGCAGCCCATGGGCCCCACCTG
CCCCACACCTGCTCCAGTTCCCCCTCCTGAGGCCCCATCGCCCTTCAGGGCCCCACCGTT
CCATCCTCCGGGCCCCATGCCCTCAGTGGGCTCCATGCCCTCAGCAGGCCCCATGCCTTC
AGCAGGCCCCATGCCCTCAGCAGGCCCTGTGCCCTCGGCACGCCCTGGACCTCCCACCAC
AGCCAACCACCTAGGCCTTTCTGTCCCAGGCCTAGTGTCTGTCCCTCCCCGGCTTCTTCC
TGGCCCTGAGAACCACCGGGCAGGCTCAAATGAGGACCCCATCCTTGCCCCTAGTGGGAC
TCCCCCACCTACTATACCCCCAGATGAAACTTTTGGGGGGAGAGTGCCCAGACCAGCCTT
TGTCCACTATGACAAGGAGGAGGCATCTGATGTGGAGATCTCCTTGGAAAGTGACTCTGA
TGACAGCGTGGTGATCGTGCCCGAGGGGCTTCCCCCCCTGCCACCCCCACCACCCTCAGG
TGCCACACCACCCCCTATAGCCCCCACTGGGCCACCAACAGCCTCCCCTCCTGTGCCAGC
GAAGGAGGAGCCTGAAGAACTTCCTGCAGCCCCAGGGCCTCTCCCGCCACCCCCACCTCC
GCCGCCGCCTGTTCCTGGTCCTGTGACGCTCCCTCCACCCCAGTTGGTCCCTGAAGGGAC
TCCTGGTGGGGGAGGACCCCCAGCCCTGGAAGAGGATTTGACAGTTATTAATATCAACAG
CAGTGATGAAGAGGAGGAGGAAGAGGAAGAAGAGGAAGAAGAAGAAGAGGAAGAAGAGGA
AGAGGAGGAAGACTTTGAGGAAGAGGAAGAGGATGAAGAGGAATATTTTGAAGAGGAAGA
AGAGGAGGAAGAAGAGTTTGAGGAAGAATTTGAGGAAGAAGAAGGTGAGTTAGAGGAAGA
AGAAGAAGAGGAGGATGAGGAGGAGGAAGAAGAACTGGAAGAGGTGGAAGACCTGGAGTT
TGGCACAGCAGGAGGGGAGGTAGAAGAAGGTGCACCTCCACCCCCAACCCTGCCTCCAGC
TCTGCCTCCCCCTGAGTCTCCCCCAAAGGTGCAGCCAGAACCCGAACCTGAACCCGGGCT
GCTTTTGGAAGTGGAGGAGCCAGGGACGGAGGAGGAGCGTGGGGCTGACACAGCTCCCAC
CCTGGCCCCTGAAGCGCTCCCCTCCCAGGGAGAGGTGGAGAGGGAAGGGGAAAGCCCTGC
GGCAGGGCCCCCTCCCCAGGAGCTTGTTGAAGAAGAGCCCTCTGCTCCCCCAACCCTGTT
GGAAGAGGAGACTGAGGATGGGAGTGACAAGGTGCAGCCCCCACCAGAGACACCTGCAGA
AGAAGAGATGGAGACAGAGACAGAGGCCGAAGCTCTCCAGGAAAAGGAGCAGGATGACAC
AGCTGCCATGCTGGCCGACTTCATCGATTGTCCCCCTGATGATGAGAAGCCACCACCTCC
CACAGAGCCTGACTCCTAGCCATCTTCTGCACCCCACTCTTTGTTTCCAATAAAGTTATG
TCCTTAGATAGCGAAAAAAAAAAAAAAA

Protein Sequence

>27043 : length: 1180
MLLPSLSPRVQPAFTQCARPQPPPHAPSPVGGRRGVFASSRHATTGTRGKMAAAVLSGPS
AGSAAGVPGGTGGLSAVSSGPRLRLLLLESVSGLLQPRTGSAVAPVHPPNRSAPHLPGLM
CLLRLHGSVGGAQNLSALGALVSLSNARLSSIKTRFEGLCLLSLLVGESPTELFQQHCVS
WLRSIQQVLQTQDPPATMELAVAVLRDLLRYAAQLPALFRDISMNHLPGLLTSLLGLRPE
CEQSALEGMKACMTYFPRACGSLKGKLASFFLSRVDALSPQLQQLACECYSRLPSLGAGF
SQGLKHTESWEQELHSLLASLHTLLGALYEGAETAPVQNEGPGVEMLLSSEDGDAHVLLQ
LRQRFSGLARCLGLMLSSEFGAPVSVPVQEILDFICRTLSVSSKNISLHGDGPLRLLLLP
SIHLEALDLLSALILACGSRLLRFGILIGRLLPQVLNSWSIGRDSLSPGQERPYSTVRTK
VYAILELWVQVCGASAGMLQGGASGEALLTHLLSDISPPADALKLRSPRGSPDGSLQTGK
PSAPKKLKLDVGEAMAPPSHRKGDSNANSDVCAAALRGLSRTILMCGPLIKEETHRRLHD
LVLPLVMGVQQGEVLGSSPYTSSRCRRELYCLLLALLLAPSPRCPPPLACALQAFSLGQR
EDSLEVSSFCSEALVTCAALTHPRVPPLQPMGPTCPTPAPVPPPEAPSPFRAPPFHPPGP
MPSVGSMPSAGPMPSAGPMPSAGPVPSARPGPPTTANHLGLSVPGLVSVPPRLLPGPENH
RAGSNEDPILAPSGTPPPTIPPDETFGGRVPRPAFVHYDKEEASDVEISLESDSDDSVVI
VPEGLPPLPPPPPSGATPPPIAPTGPPTASPPVPAKEEPEELPAAPGPLPPPPPPPPPVP
GPVTLPPPQLVPEGTPGGGGPPALEEDLTVININSSDEEEEEEEEEEEEEEEEEEEEEDF
EEEEEDEEEYFEEEEEEEEEFEEEFEEEEGELEEEEEEEDEEEEEELEEVEDLEFGTAGG
EVEEGAPPPPTLPPALPPPESPPKVQPEPEPEPGLLLEVEEPGTEEERGADTAPTLAPEA
LPSQGEVEREGESPAAGPPPQELVEEEPSAPPTLLEEETEDGSDKVQPPPETPAEEEMET
ETEAEALQEKEQDDTAAMLADFIDCPPDDEKPPPPTEPDS