ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2672

Name

GFI1

Synonym

GFI-1|GFI1A|SCN2|ZNF163;growth factor independent 1 transcription repressor;GFI1;growth factor independent 1 transcription repressor

Definition

growth factor independence-1|growth factor independent protein 1|zinc finger protein 163|zinc finger protein Gfi-1

Position

1p22

Gene Type

protein-coding

Pathways and Diseases

Pathway

Validated targets of C-MYC transcriptional repression;PID Curated;200171

Disease

Neutropenia, severe congenital, autosomal dominant 2;OMIM

Disease

Neutropenia, nonimmune chronic idiopathic, of adults;OMIM

Disease

Prostate cancer;FunDO

External Links

Links to cell senescence gene database

2672

Links to epithelial mesenchymal transition gene database

2672

Links to ovarian cancer gene database

2672

Links to endometrial cancer gene database

2672

Links to iHOP

2672

Sequence Information

Nucleotide Sequence

>2672 : length: 5314
CAGCTGCAGCGCGGGGTTGCCTTCCCACGCGCTCGGCCCAGGCCCCGGGGCCCCTATCTC
CTCCAAACTCTGTCGCTCCCCACAGGAACCAGCAAAGCGGGCCGGGGTGCGAGAGAGGCG
TGGGCTTACAGCCCGGGTGGGGAGGCGGCCTCCGCGTCCGCCTGGTCTCTGGTGGCGCCA
GCCCAGACCCAGCTCCGGCGCTGACAGTTACCCCGCCCCCATCTGTCCCGCTCCCAGCCA
ACGTGGGTCCAAGCTGCAGCGGGACCCTCGGGACAACGCCACTCCGTTTTTCTTTTCTTC
CGAGTTTCGTGGCTGTTTAAAGAATTGGGTTTGGGGTTTGTGGCGTCTAATTGTACGGAC
GAGAAGTGCAGGAAGCGACAAAGCTCTAGCCCTAGGAGCCACCCCGGAGGGAGGCGGATG
GCACTCTCACCCCTAGGGGCATTCTGGCGCTTGGGTAGCGGGAAACTTCGCGGGAGCCCC
GCGACACGTCCCAGGCGTCTTTTCTCCCAGGTCTATTCCCATTCCTCCGGAGAAGGGGAC
ACAATGGGGCTGGGGATCTGGAGCAGGGGGCCTGCACCCTACAGGGACCAAGGCCTGTAG
GACTCGTTTGAGCTGAGAGCGCCAACGGACAGACGTAGACTGTGTGGCCTGCATCTTGCC
TAGGAAGCCGAGGGGCTCCTAGTCCGGCAGTGGAAACAGCGCGAAGCCGGAGGACTGCAG
GTCCTGCCCCGGCCCAGAGTTCCCAGCACCCTCGTTTCTGAACCAGCCGAGGCCACGGAG
AACTGCTGTACTGCAGCTCACGTGTGAACCCGGTCACCATCGCCTTCACCCCGGGAGGAA
GGCAGATTCGTTTACTCCAGACCACCTCGACTGTGGGGTACCGCCCCCGGAGCCGGCTGG
AGCCTAGCGGCAGGCGCAGCCACGCCCTCCCGCTGCGCTCAGATTTCGACCTGGTATTAG
GTCTCCTCCGGGCTGGGGCTGAGCAAGCCCTCGGAGTGACCGTGGGTGACAGCGGCTCCA
GGGACTCTTGGGGCGCAGTGGGGAAAGTGCCGGACCACCATGCCGCGCTCATTTCTCGTC
AAAAGCAAGAAGGCTCACAGCTACCACCAGCCGCGCTCCCCAGGACCAGACTATTCCCTC
CGTTTAGAGAATGTACCGGCGCCTAGCCGAGCAGACAGCACTTCAAATGCAGGCGGGGCG
AAGGCGGAGCCCCGGGACCGTTTGTCCCCCGAATCGCAGCTGACCGAAGCCCCAGACAGA
GCCTCCGCATCCCCAGACAGCTGCGAAGGCAGCGTCTGCGAACGGAGCTCGGAGTTTGAG
GACTTCTGGAGGCCCCCGTCACCCTCCGCGTCTCCAGCCTCGGAGAAGTCAATGTGCCCA
TCGCTGGACGAAGCCCAGCCCTTCCCCCTGCCTTTCAAACCGTACTCATGGAGCGGCCTG
GCGGGTTCTGACCTGCGGCACCTGGTGCAGAGCTACCGACCGTGTGGGGCCCTGGAGCGT
GGCGCTGGCCTGGGCCTCTTCTGCGAACCCGCCCCGGAGCCTGGCCACCCGGCCGCGCTG
TACGGCCCGAAGCGGGCTGCCGGCGGCGCGGGGGCCGGGGCGCCAGGGAGCTGCAGCGCA
GGGGCCGGTGCCACCGCTGGCCCTGGCCTAGGGCTCTACGGCGACTTCGGGTCTGCGGCA
GCCGGGCTGTATGAGAGGCCCACGGCAGCGGCGGGCTTGCTGTACCCCGAGCGTGGCCAC
GGGCTGCACGCAGACAAGGGCGCTGGCGTCAAGGTGGAGTCGGAGCTGCTGTGCACCCGC
CTGCTGCTGGGCGGCGGCTCCTACAAGTGCATCAAGTGCAGCAAGGTGTTCTCCACGCCG
CACGGGCTCGAGGTGCACGTGCGCAGGTCCCACAGCGGTACCAGACCCTTTGCCTGCGAG
ATGTGCGGCAAGACCTTCGGGCACGCGGTGAGCCTGGAGCAGCACAAAGCCGTGCACTCG
CAGGAACGGAGCTTTGACTGTAAGATCTGTGGGAAGAGCTTCAAGAGGTCATCCACACTG
TCCACACACCTGCTTATCCACTCAGACACTCGGCCCTACCCCTGTCAGTACTGTGGCAAG
AGGTTCCACCAGAAGTCAGACATGAAGAAACACACTTTCATCCACACTGGTGAGAAGCCT
CACAAGTGCCAGGTGTGCGGCAAGGCATTCAGCCAGAGCTCCAACCTCATCACCCACAGC
CGCAAACACACAGGCTTCAAGCCCTTCGGCTGCGACCTCTGTGGGAAGGGTTTCCAGAGG
AAGGTGGACCTCCGAAGGCACCGGGAGACGCAGCATGGGCTCAAATGAGCACCCTGGCTG
GCTGCAAGCAGCAGCTACACAACACTACAGAGGGCAGCCTCCCTGCTTGCCACCACTCTG
CTCCCTGCTTGCCTCCACTCCCTTCTGACTTTCCAGACCCCAGGTCCAGTCTGCAGATCC
TACCAGGTTGCTCCTCCTTCGCCTTACCTCCTGGAGCTGCCAGAAGAAATGAGGTACCTT
TTCAAAGTGCAGCCGAGAGTGAGAACCAAGTGACTCTCTAGGCTTCGGACACAAATAGGC
TCCTCTACACCTGAAGACAAAGGCAAAGTCAAATGGGGACCAGAATAAATCTTAGACCCC
ACAGTCCTTCCCATTTCCAGCCCTAATCTACAGACAGGAATGCCCTTCAGGTTTCTTCCC
TCCCCCCTCTTGACCTACCCCAGATATTTGTGTGGAAGAGGAGGAATCACCATTTACAAG
GTGGACAAATGCTAATATTTTTATCTAGAAAGAAGAGTGAGTGTTAACTTTTATTTTTTT
CCTTCTGGGGGGTCTGTTGACTCCTTTCTTTTGGGTGCTGCCTATAAATCTTGGAGGAAT
CATTTCTCCTCCTCAAAAACTGATTCAGAAACTGACTTGGGGAAGGAATTTAATACTTTG
AAGTCATGAGATGCACCATCGAGGCTACCCCCAAGAAGAAGCAGAAGAGAAGTTGGTAAT
GAGAGGGGATTAGAGGTCCTCCCTTCAGTAGGGCTGTGAAAACCTCATCACTGGAGGTAA
AAGCACAAGCAATGCCTGTGGACAAGATGTCATTCATTCACTCAGCAAATGTTCATGGAT
CACCGGCTACCAAGGTACCAGGCACCATGCTAGGTATTGGGGAAGAGAGACTGAAGTCAC
AACCCCTGACTGCTCCTCAAAAGCTAACGGTTGCACCTCCAAGTGGCTGGGTCTGTTCTT
ACTCTTGGAGGGAATTCTGAGAAGACAGCACAGAATTGTAAACCTTCCCTTTTGACCCTT
TTGGATTTTATCAGGTGTAAACAAAAAGCTGAACAGTTACTTCAAAGATATGTGTGTATA
TTCAGTTTTTTATTGTTAAGCTGATATTTTAAAGATTTCTGAGCTAGCAGGCATGTGGGA
AGGAAGGCTCTGTCTTCAACTCTTTGACCCTCCATGTGTACCATAGAGGGGGGAAAGGTG
GTATTTTCACTTTGATGAGGTTGGTAAATGTTTTTAGATCTTCTGGTAAGCATTATGTTT
GTTAATACATATTTATTAGAGTGATGTTTTAAGTTAATAAAGTATTAAGAGTATTACAGA
TTGCCTTTCCTTTAGGCAGGGAATTTGGGGAAGACCTTTGTTTTAGTCTGTAGGGGGAAA
GCTGGCACTGAAGGAAACTGCAATGGAGTATAAAAGTGAAGCACACAAGCTAATATCCAG
AAGAGTAAAATCCAATTGCTCGGGTTTCCATATACTTTCTCCTTTGCTGCTACACCTCAG
AGATACTTCTTTCATCTTCTTTCATAAGAGAAAAACTAGGAGGTGTACAAAACTAAGCTA
CTACCTTGTAGAGCCCCTGATGGTTCCACAGGCACGTAAGTAAGCTCTTTCCTCTGAAAA
TGTCAACATATTTTTTTAGGGGCCTGAAGGCTCCCAGATGAATAAAGAAATCACAGGTCT
TAGGTCTAGGTTTTAGTTTTAGTCACAGCTCTGTCACCAACACATCATGTGACTTGTGTA
AATCTTTTGACTTCCCCGATACTGGTTTCCTTGATCAAGTAATACGGAGACAGCTCTGTC
ATTCCTGTCCAACCCTGACCGCTTTGATTCTGTGGAGACTGGAAAGGAAAAAAAGTGTGA
GATTGGTTAGCTGCCTCCCCTAATGCAAGTCACAAATCTAAAGGCCCATGAGGATCTGGG
TTATTTCTGGTTCTGTCCCACCTGTGGGAGTTTTTTGCATAAGTCAATCCTTTAAGAGAA
TGAAACCAGAATAAAATCCTGGCCAAAATCCCTACTACTAGTGCTTTAACACCTCCCAGC
CAGACATTCAGGGTATGCATGCCCCATGGTGAGAACCAGCAGATTGCCCATTTCCAACTC
AAATTGATTTCACACATATAATTGAGCACCCAGTATGTGCTGGGCATTCTTCTAGGGGGT
GGAGATATAGCAGTGAGGACAATGTCTTACGAAGCTTTATTTATTCATTGTTGAATCCTC
AGTTCCCAGAATAGTGCCTGGCACACAGTAGGAGATTAATAAATATTTACTGAGATGTTA
AGTGAATAAACAGAAAATAAGCTCCTGCTTCATCCTAGGGCCTGGCTCTGCTCTCTACAG
CACAAAGGGAAGAGAGATTGCTTGACAGCCTGGGAAACAAATAGAATCCACACGACTTTC
TCTCCAGGTTGGCAGGAAAGGGGGGCTTGAATGCTGCTTTTCTCTGGTTTCTCCAAATCT
CAGTCCTTGGCTGTCCTCACCTGATTTCCAGCACCATGTCTTTCCATGTCAGTTTACTCT
CATTCAGAATTTAAATTCGTTTACTCTGTAATGGAGTTTAAGATAGTTTTTCAGAACTGA
TGGATGATGAACAGTTGCAGCGTCCAGGAACCACTTCCTAGTGTCCTGGGAGACAATCCT
CCCAGTGAATGAAAATGACAAAAACATCCTTCCCACAGAAGTCACCCTGTGTACTGGTTG
GTTATTTCCAACCTGGTTTGAAAAGTAAAGAAGTTGCACTGAGGGGTAAGTAGAACTGAT
TGAAATCTAGGTGCCTGTGCTGTCCTGCTCTTCCCTTATGACGTTTAGAACATTTGGTCC
ATTTTTGTTATCCCTGTTTATGCTCTAAGTGAGGAATTGTAATTTTGATGTTAACTGTAT
GCCTTTTTTTTTTTTTTTTGGTAAAAAATGTATCTTGATATCCCCAGTTCAGAATCAAAA
CAAATTACTGTGCCTGTTACCGTGTGAAATTTGAAGATTGCAAATATCTCTCTTAATGTT
ATTACTTGACTCCATTAAAAATAGATTGTGAATA

Protein Sequence

>2672 : length: 422
MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQ
LTEAPDRASASPDSCEGSVCERSSEFEDFWRPPSPSASPASEKSMCPSLDEAQPFPLPFK
PYSWSGLAGSDLRHLVQSYRPCGALERGAGLGLFCEPAPEPGHPAALYGPKRAAGGAGAG
APGSCSAGAGATAGPGLGLYGDFGSAAAGLYERPTAAAGLLYPERGHGLHADKGAGVKVE
SELLCTRLLLGGGSYKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACEMCGKTFGHAVSLE
QHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTF
IHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQHG
LK