ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

266977

Name

ADGRF1

Synonym

GPR110|KPG_012|PGR19|hGPCR36;adhesion G protein-coupled receptor F1;ADGRF1;adhesion G protein-coupled receptor F1

Definition

G protein-coupled receptor 110|G protein-coupled receptor PGR19|G-protein coupled receptor KPG_012|probable G-protein coupled receptor 110|seven transmembrane helix receptor

Position

6p12.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

266977

Links to epithelial mesenchymal transition gene database

266977

Links to ovarian cancer gene database

266977

Links to endometrial cancer gene database

266977

Links to iHOP

266977

Sequence Information

Nucleotide Sequence

>266977 : length: 5468
AGTAATGCGTGCCAGGAATTGCTGATGGATCAGTGAGCCTGTGTTCATGCCAGTGAGCTG
CTGTGGCTCAGATACTGATACTTTCTTTCCAAACAGCATAAGAAGTGATTGAGCCACAAG
TATACTGAAGGAAGGGCTCCCTCGAGTTCTGGTGTGAAGAGATAAATCACCAGTCACAGA
CTATGCACCCGACTGCTGCTGTTCAGTCCAGGGAAAATGAAAGTTGGAGTGCTGTGGCTC
ATTTCTTTCTTCACCTTCACTGACGGCCACGGTGGCTTCCTGGGGAAAAATGATGGCATC
AAAACAAAAAAAGAACTCATTGTGAATAAGAAAAAACATCTAGGCCCAGTCGAAGAATAT
CAGCTGCTGCTTCAGGTGACCTATAGAGATTCCAAGGAGAAAAGAGATTTGAGAAATTTT
CTGAAGCTCTTGAAGCCTCCATTATTATGGTCACATGGGCTAATTAGAATTATCAGAGCA
AAGGCTACCACAGACTGCAACAGCCTGAATGGAGTCCTGCAGTGTACCTGTGAAGACAGC
TACACCTGGTTTCCTCCCTCATGCCTTGATCCCCAGAACTGCTACCTTCACACGGCTGGA
GCACTCCCAAGCTGTGAATGTCATCTCAACAACCTCAGCCAGAGTGTCAATTTCTGTGAG
AGAACAAAGATTTGGGGCACTTTCAAAATTAATGAAAGGTTTACAAATGACCTTTTGAAT
TCATCTTCTGCTATATACTCCAAATATGCAAATGGAATTGAAATTCAACTTAAAAAAGCA
TATGAAAGAATTCAAGGTTTTGAGTCGGTTCAGGTCACCCAATTTCGAAATGGAAGCATC
GTTGCTGGGTATGAAGTTGTTGGCTCCAGCAGTGCATCTGAACTGCTGTCAGCCATTGAA
CATGTTGCCGAGAAGGCTAAGACAGCCCTTCACAAGCTGTTTCCATTAGAAGACGGCTCT
TTCAGAGTGTTCGGAAAAGCCCAGTGTAATGACATTGTCTTTGGATTTGGGTCCAAGGAT
GATGAATATACCCTGCCCTGCAGCAGTGGCTACAGGGGAAACATCACAGCCAAGTGTGAG
TCCTCTGGGTGGCAGGTCATCAGGGAGACTTGTGTGCTCTCTCTGCTTGAAGAACTGAAC
AAGAATTTCAGTATGATTGTAGGCAATGCCACTGAGGCAGCTGTGTCATCCTTCGTGCAA
AATCTTTCTGTCATCATTCGGCAAAACCCATCAACCACAGTGGGGAATCTGGCTTCGGTG
GTGTCGATTCTGAGCAATATTTCATCTCTGTCACTGGCCAGCCATTTCAGGGTGTCCAAT
TCAACAATGGAGGATGTCATCAGTATAGCTGACAATATCCTTAATTCAGCCTCAGTAACC
AACTGGACAGTCTTACTGCGGGAAGAAAAGTATGCCAGCTCACGGTTACTAGAGACATTA
GAAAACATCAGCACTCTGGTGCCTCCGACAGCTCTTCCTCTGAATTTTTCTCGGAAATTC
ATTGACTGGAAAGGGATTCCAGTGAACAAAAGCCAACTCAAAAGGGGTTACAGCTATCAG
ATTAAAATGTGTCCCCAAAATACATCTATTCCCATCAGAGGCCGTGTGTTAATTGGGTCA
GACCAATTCCAGAGATCCCTTCCAGAAACTATTATCAGCATGGCCTCGTTGACTCTGGGG
AACATTCTACCCGTTTCCAAAAATGGAAATGCTCAGGTCAATGGACCTGTGATATCCACG
GTTATTCAAAACTATTCCATAAATGAAGTTTTCCTATTTTTTTCCAAGATAGAGTCAAAC
CTGAGCCAGCCTCATTGTGTGTTTTGGGATTTCAGTCATTTGCAGTGGAACGATGCAGGC
TGCCACCTAGTGAATGAAACTCAAGACATCGTGACGTGCCAATGTACTCACTTGACCTCC
TTCTCCATATTGATGTCACCTTTTGTCCCCTCTACAATCTTCCCCGTTGTAAAATGGATC
ACCTATGTGGGACTGGGTATCTCCATTGGAAGTCTCATTTTATGCCTGATCATCGAGGCT
TTGTTTTGGAAGCAGATTAAAAAAAGCCAAACCTCTCACACACGTCGTATTTGCATGGTG
AACATAGCCCTGTCCCTCTTGATTGCTGATGTCTGGTTTATTGTTGGTGCCACAGTGGAC
ACCACGGTGAACCCTTCTGGAGTCTGCACAGCTGCTGTGTTCTTTACACACTTCTTCTAC
CTCTCTTTGTTCTTCTGGATGCTCATGCTTGGCATCCTGCTGGCTTACCGGATCATCCTC
GTGTTCCATCACATGGCCCAGCATTTGATGATGGCTGTTGGATTTTGCCTGGGTTATGGG
TGCCCTCTCATTATATCTGTCATTACCATTGCTGTCACGCAACCTAGCAATACCTACAAA
AGGAAAGATGTGTGTTGGCTTAACTGGTCCAATGGAAGCAAACCACTCCTGGCTTTTGTT
GTCCCTGCACTGGCTATTGTGGCTGTGAACTTCGTTGTGGTGCTGCTAGTTCTCACAAAG
CTCTGGAGGCCGACTGTTGGGGAAAGACTGAGTCGGGATGACAAGGCCACCATCATCCGC
GTGGGGAAGAGCCTCCTCATTCTGACCCCTCTGCTAGGGCTCACCTGGGGCTTTGGAATA
GGAACAATAGTGGACAGCCAGAATCTGGCTTGGCATGTTATTTTTGCTTTACTCAATGCA
TTCCAGGGATTTTTTATCTTATGCTTTGGAATACTCTTGGACAGTAAGCTGCGACAACTT
CTGTTCAACAAGTTGTCTGCCTTAAGTTCTTGGAAGCAAACAGAAAAGCAAAACTCATCA
GATTTATCTGCCAAACCCAAATTCTCAAAGCCTTTCAACCCACTGCAAAACAAAGGCCAT
TATGCATTTTCTCATACTGGAGATTCCTCCGACAACATCATGCTAACTCAGTTTGTCTCA
AATGAATAAGGCAAGGAATCATAAAATCAAGAAAAAATTTCCAGAACAACTTGACATTTA
GAGACAAATGTCAATGAAGAAATTATGCTCAGTATTCGATCGGGTTTTCTGATTTAGGGG
TCTGGGAATAAAACAAGAATGTCTCAGTGGCTTCATTACTGCTCCCTTTTGTCTTCAATT
AAATGAAAAGAAGATTTATTTCCATGTGATTTGATTCAAAGAAAGTGCTCCATAAATGCA
GAAGAGTAGGTTTTGTTGGAAATCGTGTCAGTTGTACCCTGACCATAAAATATGGTTTCT
ATTTTCATAAAACAGCATTATTCACATGGCATTTCCAATAATCTGGATTGAAGGAAGAAA
ATTTTATGAAATAGCTTTAGATAAATTAATAGGCCACGTTCATTTTCTTGTCAAAAAGTT
ACTGGTGGGGGGATGGTGGGAAAAAGTTATTAGTGCAAATTTCCTAGAGAAAAAACCATT
TCTCTTTCAAATTTTCCAGTTGAATTTTATGTTCGCTTTTGCTTCTTAGGTTCTATCACT
TAATATTGAAAGTTAATCAGAAATAAAATGTAAACTTCTATTTCAGATAGCTTTGTAACC
ATTTATCAGAAAGTATAATAATGTGATATGATATATAATGTGGTATTTTTCAGTTTACAA
GGCACTTCCATCTGGTCCTAAACCCTGCAAACAAAAGTGTCAAGGCAGACCTAGTGCAGA
GATGAGGGCATGGGGGCTCAGAGAGGTAAAGTGACTTGCCAAAGATTGTGAAGCCAGTTA
AGGGAAATTGGGGATTTTTAGGACATTTGTCTCCCAGACCATTTCTACAGCCAATAAAAG
CCTTGAAAATTACCTACATCTCTAGTAAATCTTTCTGAGGTCAGTTACACAGTTCACCAT
TCCCAGAATTCTATGTAAGAGAGAAATTAAGGGAGAATTTGGTTGTCAGCTTCCAGGGAG
GTACCTTAAAACATCCTTATTTTCTTTCATAATACACCATAGGCACTTTGTGGAAGTTAT
TTTCTTGTACAGCCAGTGCCACTTTTGGATGACATACAAAGCAGCAGGAGTTGACGCTAT
GTGAAGCAACACTTCTCTTCCATACTTCCATCACATTTGGCTCACCTACCTGAGTTTCAG
CCGTGACCATAGTGCCCAGAGGAACCCGAGCCTTTGATTCATCCTTGCTGTTTTGAGAGG
CCTAGGGAGTGTCTCTTAGCCTCCTGACATGGAAAGCCTTCATGCTATGCAAATAAAGAC
AGCTGGGGGAACTTCTAGTTAGTGGTGGTAGATTAAATAAGCATACCTGAGAGAAATTCA
AAGTTAGACTTCCACAAGGCACCAAGGTGCAGCACACATGAAATATGAAAGTGAGAGGTT
CAAAGGAAATGACTGAGGATCAGTTAGATGGTTCTATACCCCACAAATATGTATGAGAGT
CAACAGAATTTTATGAGAAAGACTTCTTTGCAGAAAACTGCTCTATGAGCCTTCTCACTC
TACCTACCCACAAAAGTGAGAGAAGGAGGAATGTCTGCTCCTTGACCTCAAATTTAGTGA
GAGAAGATTTCTCAGATAGCTCAGATAGCTCAGATTTCTCAGAACCACAACAATTAGGAT
GCATGGCTGATGGAAGTCTGATTCTTGCCTAGAATTGTGGCCACAGCTCCGGTAGTAGAG
CCCTGAATGAGTTCTGTGTTGAGAATAGCCTGTATGTCTAGTGTTTGTCAGGGCAATGGA
TGTGTGTGTTTCCCATGAACCATAGTGAGACATGCAAGAGTGAAGGTCAGCATGGGGCTC
TTTTAGGTCCTCTCTGATAGGGTTGTCCAAAGAGGTGGAGGGAACCCAGCATCAAGAAGT
GGGAGGTGAAGCCAGATTGTGGGATGAGGAAGGAGTCACAAATGACCACCTGGAATACAA
AAAAATCTACACAAGCTAAAGATGAGAAGTCAGGGCTATGAGAATTTCTATGGGAGTTCT
TGAATGCTCCCTCTCTTATTACACACAATTACTATCCAGAGAACCCTGACACCATGTGAA
GGCAGCCCTATCTCATAAGACAGATTTCTTTTTTTGGGGACCTTGGGGAAAGGGAGGCCA
GAAACCTCCGTGTCCAAGGTGGGGTGGAAGGAGAGGGAGAAATCTTAGCAAAAATGTCAA
CCAGCAAGGGAAGATGTGCTAGCGCAAGTAGGCAACTCAACACAAGACTCAGTTGGAGAG
GGAAGAAAAATTTAGTACTAAATTATTGTAGTTTCTTCTTATTGTAGGCGACTGGGAGTC
ATAATTACCAAACTATTTAAAATGACCAAAATGTTGCTCTTACCTGAGTATGTTGGCATA
CAACTGGAATGTATCTGATGGAAGAAAAAGCTTCTCCCACTGAATAAATTTTATGAGGAT
GATGAGAGACAAAAAAATGTTTGATCAGATATCATGTATGTGCATGCTTGTCTAATTCAC
TGATTATGCATACATTCACCTCAAAATGCTACTAAAACAACAATAAAATAATGAAAAAGT
GAATAGCA

Protein Sequence

>266977 : length: 910
MKVGVLWLISFFTFTDGHGGFLGKNDGIKTKKELIVNKKKHLGPVEEYQLLLQVTYRDSK
EKRDLRNFLKLLKPPLLWSHGLIRIIRAKATTDCNSLNGVLQCTCEDSYTWFPPSCLDPQ
NCYLHTAGALPSCECHLNNLSQSVNFCERTKIWGTFKINERFTNDLLNSSSAIYSKYANG
IEIQLKKAYERIQGFESVQVTQFRNGSIVAGYEVVGSSSASELLSAIEHVAEKAKTALHK
LFPLEDGSFRVFGKAQCNDIVFGFGSKDDEYTLPCSSGYRGNITAKCESSGWQVIRETCV
LSLLEELNKNFSMIVGNATEAAVSSFVQNLSVIIRQNPSTTVGNLASVVSILSNISSLSL
ASHFRVSNSTMEDVISIADNILNSASVTNWTVLLREEKYASSRLLETLENISTLVPPTAL
PLNFSRKFIDWKGIPVNKSQLKRGYSYQIKMCPQNTSIPIRGRVLIGSDQFQRSLPETII
SMASLTLGNILPVSKNGNAQVNGPVISTVIQNYSINEVFLFFSKIESNLSQPHCVFWDFS
HLQWNDAGCHLVNETQDIVTCQCTHLTSFSILMSPFVPSTIFPVVKWITYVGLGISIGSL
ILCLIIEALFWKQIKKSQTSHTRRICMVNIALSLLIADVWFIVGATVDTTVNPSGVCTAA
VFFTHFFYLSLFFWMLMLGILLAYRIILVFHHMAQHLMMAVGFCLGYGCPLIISVITIAV
TQPSNTYKRKDVCWLNWSNGSKPLLAFVVPALAIVAVNFVVVLLVLTKLWRPTVGERLSR
DDKATIIRVGKSLLILTPLLGLTWGFGIGTIVDSQNLAWHVIFALLNAFQGFFILCFGIL
LDSKLRQLLFNKLSALSSWKQTEKQNSSDLSAKPKFSKPFNPLQNKGHYAFSHTGDSSDN
IMLTQFVSNE