ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

26585

Name

GREM1

Synonym

C15DUPq|CKTSF1B1|CRAC1|CRCS4|DAND2|DRM|DUP15q|GREMLIN|HMPS|HMPS1|IHG-2|MPSH|PIG2;gremlin 1, DAN family BMP antagonist;GREM1;gremlin 1, DAN family BMP antagonist

Definition

DAN domain family member 2|cell proliferation-inducing gene 2 protein|colorectal adenoma and carcinoma 1|cysteine knot superfamily 1, BMP antagonist 1|down-regulated in Mos-transformed cells protein|gremlin 1, cysteine knot superfamily, homolog|gremlin 1-

Position

15q13.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

BMP receptor signaling;PID Curated;200123

Disease

Embryoma;FunDO

Disease

Diabetes mellitus;FunDO

Disease

nonsyndromic cleft lip with or without cleft palate;GAD

Disease

Basal cell carcinoma;FunDO

Disease

Kidney disease;FunDO

Disease

DEVELOPMENTAL;GAD

Disease

Hypertension, Pulmonary;FunDO

External Links

Links to cell senescence gene database

26585

Links to epithelial mesenchymal transition gene database

26585

Links to ovarian cancer gene database

26585

Links to endometrial cancer gene database

26585

Links to iHOP

26585

Sequence Information

Nucleotide Sequence

>26585 : length: 4164
ATTTAAACGGGAGACGGCGCGATGCCTGGCACTCGGTGCGCCTTCCGCGGACCGGGCGAC
CCAGTGCACGGCCGCCGCGTCACTCTCGGTCCCGCTGACCCCGCGCCGAGCCCCGGCGGC
TCTGGCCGCGGCCGCACTCAGCGCCACGCGTCGAAAGCGCAGGCCCCGAGGACCCGCCGC
ACTGACAGTATGAGCCGCACAGCCTACACGGTGGGAGCCCTGCTTCTCCTCTTGGGGACC
CTGCTGCCGGCTGCTGAAGGGAAAAAGAAAGGGTCCCAAGGTGCCATCCCCCCGCCAGAC
AAGGCCCAGCACAATGACTCAGAGCAGACTCAGTCGCCCCAGCAGCCTGGCTCCAGGAAC
CGGGGGCGGGGCCAAGGGCGGGGCACTGCCATGCCCGGGGAGGAGGTGCTGGAGTCCAGC
CAAGAGGCCCTGCATGTGACGGAGCGCAAATACCTGAAGCGAGACTGGTGCAAAACCCAG
CCGCTTAAGCAGACCATCCACGAGGAAGGCTGCAACAGTCGCACCATCATCAACCGCTTC
TGTTACGGCCAGTGCAACTCTTTCTACATCCCCAGGCACATCCGGAAGGAGGAAGGTTCC
TTTCAGTCCTGCTCCTTCTGCAAGCCCAAGAAATTCACTACCATGATGGTCACACTCAAC
TGCCCTGAACTACAGCCACCTACCAAGAAGAAGAGAGTCACACGTGTGAAGCAGTGTCGT
TGCATATCCATCGATTTGGATTAAGCCAAATCCAGGTGCACCCAGCATGTCCTAGGAATG
CAGCCCCAGGAAGTCCCAGACCTAAAACAACCAGATTCTTACTTGGCTTAAACCTAGAGG
CCAGAAGAACCCCCAGCTGCCTCCTGGCAGGAGCCTGCTTGTGCGTAGTTCGTGTGCATG
AGTGTGGATGGGTGCCTGTGGGTGTTTTTAGACACCAGAGAAAACACAGTCTCTGCTAGA
GAGCACTCCCTATTTTGTAAACATATCTGCTTTAATGGGGATGTACCAGAAACCCACCTC
ACCCCGGCTCACATCTAAAGGGGCGGGGCCGTGGTCTGGTTCTGACTTTGTGTTTTTGTG
CCCTCCTGGGGACCAGAATCTCCTTTCGGAATGAATGTTCATGGAAGAGGCTCCTCTGAG
GGCAAGAGACCTGTTTTAGTGCTGCATTCGACATGGAAAAGTCCTTTTAACCTGTGCTTG
CATCCTCCTTTCCTCCTCCTCCTCACAATCCATCTCTTCTTAAGTTGATAGTGACTATGT
CAGTCTAATCTCTTGTTTGCCAAGGTTCCTAAATTAATTCACTTAACCATGATGCAAATG
TTTTTCATTTTGTGAAGACCCTCCAGACTCTGGGAGAGGCTGGTGTGGGCAAGGACAAGC
AGGATAGTGGAGTGAGAAAGGGAGGGTGGAGGGTGAGGCCAAATCAGGTCCAGCAAAAGT
CAGTAGGGACATTGCAGAAGCTTGAAAGGCCAATACCAGAACACAGGCTGATGCTTCTGA
GAAAGTCTTTTCCTAGTATTTAACAGAACCCAAGTGAACAGAGGAGAAATGAGATTGCCA
GAAAGTGATTAACTTTGGCCGTTGCAATCTGCTCAAACCTAACACCAAACTGAAAACATA
AATACTGACCACTCCTATGTTCGGACCCAAGCAAGTTAGCTAAACCAAACCAACTCCTCT
GCTTTGTCCCTCAGGTGGAAAAGAGAGGTAGTTTAGAACTCTCTGCATAGGGGTGGGAAT
TAATCAAAAACCGCAGAGGCTGAAATTCCTAATACCTTTCCTTTATCGTGGTTATAGTCA
GCTCATTTCCATTCCACTATTTCCCATAATGCTTCTGAGAGCCACTAACTTGATTGATAA
AGATCCTGCCTCTGCTGAGTGTACCTGACAGTAGTCTAAGATGAGAGAGTTTAGGGACTA
CTCTGTTTTAGCAAGAGATATTTTGGGGGTCTTTTTGTTTTAACTATTGTCAGGAGATTG
GGCTAAAGAGAAGACGACGAGAGTAAGGAAATAAAGGGAATTGCCTCTGGCTAGAGAGTA
GTTAGGTGTTAATACCTGGTAGAGATGTAAGGGATATGACCTCCCTTTCTTTATGTGCTC
ACTGAGGATCTGAGGGGACCCTGTTAGGAGAGCATAGCATCATGATGTATTAGCTGTTCA
TCTGCTACTGGTTGGATGGACATAACTATTGTAACTATTCAGTATTTACTGGTAGGCACT
GTCCTCTGATTAAACTTGGCCTACTGGCAATGGCTACTTAGGATTGATCTAAGGGCCAAA
GTGCAGGGTGGGTGAACTTTATTGTACTTTGGATTTGGTTAACCTGTTTTCTTCAAGCCT
GAGGTTTTATATACAAACTCCCTGAATACTCTTTTTGCCTTGTATCTTCTCAGCCTCCTA
GCCAAGTCCTATGTAATATGGAAAACAAACACTGCAGACTTGAGATTCAGTTGCCGATCA
AGGCTCTGGCATTCAGAGAACCCTTGCAACTCGAGAAGCTGTTTTTATTTCGTTTTTGTT
TTGATCCAGTGCTCTCCCATCTAACAACTAAACAGGAGCCATTTCAAGGCGGGAGATATT
TTAAACACCCAAAATGTTGGGTCTGATTTTCAAACTTTTAAACTCACTACTGATGATTCT
CACGCTAGGCGAATTTGTCCAAACACATAGTGTGTGTGTTTTGTATACACTGTATGACCC
CACCCCAAATCTTTGTATTGTCCACATTCTCCAACAATAAAGCACAGAGTGGATTTAATT
AAGCACACAAATGCTAAGGCAGAATTTTGAGGGTGGGAGAGAAGAAAAGGGAAAGAAGCT
GAAAATGTAAAACCACACCAGGGAGGAAAAATGACATTCAGAACCAGCAAACACTGAATT
TCTCTTGTTGTTTTAACTCTGCCACAAGAATGCAATTTCGTTAACGGAGATGACTTAAGT
TGGCAGCAGTAATCTTCTTTTAGGAGCTTGTACCACAGTCTTGCACATAAGTGCAGATTT
GGCTCAAGTAAAGAGAATTTCCTCAACACTAACTTCACTGGGATAATCAGCAGCGTAACT
ACCCTAAAAGCATATCACTAGCCAAAGAGGGAAATATCTGTTCTTCTTACTGTGCCTATA
TTAAGACTAGTACAAATGTGGTGTGTCTTCCAACTTTCATTGAAAATGCCATATCTATAC
CATATTTTATTCGAGTCACTGATGATGTAATGATATATTTTTTCATTATTATAGTAGAAT
ATTTTTATGGCAAGATATTTGTGGTCTTGATCATACCTATTAAAATAATGCCAAACACCA
AATATGAATTTTATGATGTACACTTTGTGCTTGGCATTAAAAGAAAAAAACACACATCCT
GGAAGTCTGTAAGTTGTTTTTTGTTACTGTAGGTCTTCAAAGTTAAGAGTGTAAGTGAAA
AATCTGGAGGAGAGGATAATTTCCACTGTGTGGAATGTGAATAGTTAAATGAAAAGTTAT
GGTTATTTAATGTAATTATTACTTCAAATCCTTTGGTCACTGTGATTTCAAGCATGTTTT
CTTTTTCTCCTTTATATGACTTTCTCTGAGTTGGGCAAAGAAGAAGCTGACACACCGTAT
GTTGTTAGAGTCTTTTATCTGGTCAGGGGAAACAAAATCTTGACCCAGCTGAACATGTCT
TCCTGAGTCAGTGCCTGAATCTTTATTTTTTAAATTGAATGTTCCTTAAAGGTTAACATT
TCTAAAGCAATATTAAGAAAGACTTTAAATGTTATTTTGGAAGACTTACGATGCATGTAT
ACAAACGAATAGCAGATAATGATGACTAGTTCACACATAAAGTCCTTTTAAGGAGAAAAT
CTAAAATGAAAAGTGGATAAACAGAACATTTATAAGTGATCAGTTAATGCCTAAGAGTGA
AAGTAGTTCTATTGACATTCCTCAAGATATTTAATATCAACTGCATTATGTATTATGTCT
GCTTAAATCATTTAAAAACGGCAAAGAATTATATAGACTATGAGGTACCTTGCTGTGTAG
GAGGATGAAAGGGGAGTTGATAGTCTCATAAAACTAATTTGGCTTCAAGTTTCATGAATC
TGTAACTAGAATTTAATTTTCACCCCAATAATGTTCTATATAGCCTTTGCTAAAGAGCAA
CTAATAAATTAAACCTATTCTTTC

Protein Sequence

>26585 : length: 240
MPGTRCAFRGPGDPVHGRRVTLGPADPAPSPGGSGRGRTQRHASKAQAPRTRRTDSMSRT
AYTVGALLLLLGTLLPAAEGKKKGSQGAIPPPDKAQHNDSEQTQSPQQPGSRNRGRGQGR
GTAMPGEEVLESSQEALHVTERKYLKRDWCKTQPLKQTIHEEGCNSRTIINRFCYGQCNS
FYIPRHIRKEEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD