ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2627

Name

GATA6

Synonym

GATA binding protein 6;GATA6;GATA binding protein 6

Definition

GATA-binding factor 6|transcription factor GATA-6

Position

18q11.1-q11.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Notch-mediated HES/HEY network;PID Curated;200196

Disease

Polycystic ovary syndrome;FunDO

Disease

Cancer;FunDO

Disease

Tuberculosis;NHGRI

External Links

Links to cell senescence gene database

2627

Links to epithelial mesenchymal transition gene database

2627

Links to ovarian cancer gene database

2627

Links to endometrial cancer gene database

2627

Links to iHOP

2627

Sequence Information

Nucleotide Sequence

>2627 : length: 3785
AGTTCCGACCCACAGCCTGGCACCCTTCGGCGAGCGCTGTTTGTTTAGGGCTCGGTGAGT
CCAATCAGGAGCCCAGGCTGCAGTTTTCCGGCAGAGCAGTAAGAGGCGCCTCCTCTCTCC
TTTTTATTCACCAGCAGCGCGGCGCAGACCCCGGACTCGCGCTCGCCCGCTGGCGCCCTC
GGCTTCTCTCCGCGCCTGGGAGCACCCTCCGCCGCGGCCGTTCTCCATGCGCAGCGCCCG
CCCGAGGAGCTAGACGTCAGCTTGGAGCGGCGCCGGACCGTGGATGGCCTTGACTGACGG
CGGCTGGTGCTTGCCGAAGCGCTTCGGGGCCGCGGGTGCGGACGCCAGCGACTCCAGAGC
CTTTCCAGCGCGGGAGCCCTCCACGCCGCCTTCCCCCATCTCTTCCTCGTCCTCCTCCTG
CTCCCGGGGCGGAGAGCGGGGCCCCGGCGGCGCCAGCAACTGCGGGACGCCTCAGCTCGA
CACGGAGGCGGCGGCCGGACCCCCGGCCCGCTCGCTGCTGCTCAGTTCCTACGCTTCGCA
TCCCTTCGGGGCTCCCCACGGACCTTCGGCGCCTGGGGTCGCGGGCCCCGGGGGCAACCT
GTCGAGCTGGGAGGACTTGCTGCTGTTCACTGACCTCGACCAAGCCGCGACCGCCAGCAA
GCTGCTGTGGTCCAGCCGCGGCGCCAAGCTGAGCCCCTTCGCACCCGAGCAGCCGGAGGA
GATGTACCAGACCCTCGCCGCTCTCTCCAGCCAGGGTCCGGCCGCCTACGACGGCGCGCC
CGGCGGCTTCGTGCACTCTGCGGCCGCGGCGGCAGCAGCCGCGGCGGCGGCCAGCTCCCC
GGTCTACGTGCCCACCACCCGCGTGGGTTCCATGCTGCCCGGCCTACCGTACCACCTGCA
GGGGTCGGGCAGTGGGCCAGCCAACCACGCGGGCGGCGCGGGCGCGCACCCCGGCTGGCC
TCAGGCCTCGGCCGACAGCCCTCCATACGGCAGCGGAGGCGGCGCGGCTGGCGGCGGGGC
CGCGGGGCCTGGCGGCGCTGGCTCAGCCGCGGCGCACGTCTCGGCGCGCTTCCCCTACTC
TCCCAGCCCGCCCATGGCCAACGGCGCCGCGCGGGAGCCGGGAGGCTACGCGGCGGCGGG
CAGTGGGGGCGCGGGAGGCGTGAGCGGCGGCGGCAGTAGCCTGGCGGCCATGGGCGGCCG
CGAGCCCCAGTACAGCTCGCTGTCGGCCGCGCGGCCGCTGAACGGGACGTACCACCACCA
CCACCACCACCACCACCACCATCCGAGCCCCTACTCGCCCTACGTGGGGGCGCCACTGAC
GCCTGCCTGGCCCGCCGGACCCTTCGAGACCCCGGTGCTGCACAGCCTGCAGAGCCGCGC
CGGAGCCCCGCTCCCGGTGCCCCGGGGTCCCAGTGCAGACCTGCTGGAGGACCTGTCCGA
GAGCCGCGAGTGCGTGAACTGCGGCTCCATCCAGACGCCGCTGTGGCGGCGGGACGGCAC
CGGCCACTACCTGTGCAACGCCTGCGGGCTCTACAGCAAGATGAACGGCCTCAGCCGGCC
CCTCATCAAGCCGCAGAAGCGCGTGCCTTCATCACGGCGGCTTGGATTGTCCTGTGCCAA
CTGTCACACCACAACTACCACCTTATGGCGCAGAAACGCCGAGGGTGAACCCGTGTGCAA
TGCTTGTGGACTCTACATGAAACTCCATGGGGTGCCCAGACCACTTGCTATGAAAAAAGA
GGGAATTCAAACCAGGAAACGAAAACCTAAGAACATAAATAAATCAAAGACTTGCTCTGG
TAATAGCAATAATTCCATTCCCATGACTCCAACTTCCACCTCTTCTAACTCAGATGATTG
CAGCAAAAATACTTCCCCCACAACACAACCTACAGCCTCAGGGGCGGGTGCCCCGGTGAT
GACTGGTGCGGGAGAGAGCACCAATCCCGAGAACAGCGAGCTCAAGTATTCGGGTCAAGA
TGGGCTCTACATAGGCGTCAGTCTCGCCTCGCCGGCCGAAGTCACGTCCTCCGTGCGACC
GGATTCCTGGTGCGCCCTGGCCCTGGCCTGAGCCCACGCCGCCAGGAGGCAGGGAGGGCT
CCGCCGCGGGCCTCACTCCACTCGTGTCTGCTTTTGTGCAGCGGTCCAGACAGTGGCGAC
TGCGCTGACAGAACGTGATTCTCGTGCCTTTATTTTGAAAGAGATGTTTTTCCCAAGAGG
CTTGCTGAAAGAGTGAGAGAAGATGGAAGGGAAGGGCCAGTGCAACTGGGCGCTTGGGCC
ACTCCAGCCAGCCCGCCTCCGGGGCGGACCCTGCTCCACTTCCAGAAGCCAGGACTAGGA
CCTGGGCCTTGCCTGCTATGGAATATTGAGAGAGATTTTTTAAAAAAGATTTTGCATTTT
GTCCAAAATCATGTGCTTCTTCTGATCAATTTTGGTTGTTCCAGAATTTCTTCATACCTT
TTCCACATCCAGATTTCATGTGCGTTCATGGAGAAGATCACTTGAGGCCATTTGGTACAC
ATCTCTGGAGGCTGAGTCGGTTCATGAGGTCTCTTATCAAAAATATTACTCAGTTTGCAA
GACTGCATTGTAACTTTAACATACACTGTGACTGACGTTTCTCAAAGTTCATATTGTGTG
GCTGATCTGAAGTCAGTCGGAATTTGTAAACAGGGTAGCAAACAAGATATTTTTCTTCCA
TGTATACAATAATTTTTTTAAAAAGTGCAATTTGCGTTGCAGCAATCAGTGTTAAATCAT
TTGCATAAGATTTAACAGCATTTTTTATAATGAATGTAAACATTTTAACTTAATGGTACT
TAAAATAATTTAAAAGAAAAATGTTAACTTAGACATTCTTATGCTTCTTTTACAACTACA
TCCCATTTTATATTTCCAATTGTTAAAGAAAAATATTTCAAGAACAAATCTTCTCTCAGG
AAAATTGCCTTTCTCTATTTGTTAAGAATTTTTATACAAGAACACCAATATACCCCCTTT
ATTTTACTGTGGAATATGTGCTGGAAAAATTGCAACAACACTTTACTACCTAACGGATAG
CATTTGTAAATACTCTAGGTATCTGTAAACACTCTGATGAAGTCTGTATAGTGTGACTAA
CCCACAGGCAGGTTGGTTTACATTAATTTTTTTTTTTGAATGGGATGTCCTATGGAAACC
TATTTCACCAGAGTTTTAAAAATAAAAAGGGTATTGTTTTGTCTTCTGTACAGTGAGTTC
CTTCCCTTTTCAAAGCTTTCTTTTTATGCTGTATGTGACTATAGATATTCATATAAAACA
AGTGCACGTGAAGTTTGCAAAATGCTTTAAGGCCTTCCTTTCAAAGCATAGTCCTTTTGG
AGCCGTTTTGTACCTTTTATACCTTGGCTTATTTGAAGTTGACACATGGGGTTAGTTACT
ACTCTCCATGTGCATTGGGGACAGTTTTTATAAGTGGGAAGGACTCAGTATTATTATATT
TGAGATGATAAGCATTTTGTTTGGGAACAATGCTTAAAAATATTCCAGAAAGTTCAGATT
TTTTTTCTTTGTGAATGAAATATATTCTGGCCCACGAACAGGGCGATTTCCTTTCAGTTT
TTTCCTTTTGCAACGTGCCTTGAAGTCTCAAAGCTCACCTGAGGTTGCAGACGTTACCCC
CAACAGAAGATAGGTAGAAATGATTCCAGTGGCCTCTTTGTATTTTCTTCATTGTTGAGT
AGATTTCAGGAAATCAGGAGGTGTTTCACAATACAGAATGATGGCCTTTAACTGTGAAAA
AAAAA

Protein Sequence

>2627 : length: 595
MALTDGGWCLPKRFGAAGADASDSRAFPAREPSTPPSPISSSSSSCSRGGERGPGGASNC
GTPQLDTEAAAGPPARSLLLSSYASHPFGAPHGPSAPGVAGPGGNLSSWEDLLLFTDLDQ
AATASKLLWSSRGAKLSPFAPEQPEEMYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAA
AAASSPVYVPTTRVGSMLPGLPYHLQGSGSGPANHAGGAGAHPGWPQASADSPPYGSGGG
AAGGGAAGPGGAGSAAAHVSARFPYSPSPPMANGAAREPGGYAAAGSGGAGGVSGGGSSL
AAMGGREPQYSSLSAARPLNGTYHHHHHHHHHHPSPYSPYVGAPLTPAWPAGPFETPVLH
SLQSRAGAPLPVPRGPSADLLEDLSESRECVNCGSIQTPLWRRDGTGHYLCNACGLYSKM
NGLSRPLIKPQKRVPSSRRLGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRP
LAMKKEGIQTRKRKPKNINKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASG
AGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDSWCALALA