ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2623

Name

GATA1

Synonym

ERYF1|GATA-1|GF-1|GF1|NF-E1|NFE1|XLANP|XLTDA|XLTT;GATA binding protein 1 (globin transcription factor 1);GATA1;GATA binding protein 1 (globin transcription factor 1)

Definition

GATA-binding factor 1|NF-E1 DNA-binding protein|erythroid transcription factor|erythroid transcription factor 1|globin transcription factor 1|nuclear factor, erythroid 1|transcription factor GATA1

Position

Xp11.23

Gene Type

protein-coding

Pathways and Diseases

Pathway

Notch-mediated HES/HEY network;PID Curated;200196

Pathway

Signaling events mediated by HDAC Class II;PID Curated;200019

Pathway

C-MYB transcription factor network;PID Curated;200130

Pathway

Signaling events mediated by HDAC Class I;PID Curated;200070

Pathway

hemoglobins chaperone;PID BioCarta;100250

Disease

Hereditary disease;FunDO

Disease

Bone marrow disease;FunDO

Disease

Myeloproliferative disease;FunDO

Disease

Thrombocytopenia with beta-thalassemia, X-linked;OMIM

Disease

Thrombocytopenia;FunDO

Disease

macrothrombocytopenia and anemia;GAD

Disease

Anemia, X-linked, without thrombocytopenia;OMIM

Disease

Leukemia, megakaryoblastic, with or without Down syndrome;OMIM

Disease

Leukemia, megakaryoblastic, of Down syndrome;OMIM

Disease

Lymphoma;FunDO

Disease

Leukemia;FunDO

Disease

Aplastic anemia;FunDO

Disease

Macrothrombocytopenia;OMIM

Disease

megakaryocytic malignancies;GAD

Disease

Down syndrome;FunDO

Disease

Hematopoietic system disease;FunDO

Disease

Dyserythropoietic anemia with thrombocytopenia;OMIM

External Links

Links to cell senescence gene database

2623

Links to epithelial mesenchymal transition gene database

2623

Links to ovarian cancer gene database

2623

Links to endometrial cancer gene database

2623

Links to iHOP

2623

Sequence Information

Nucleotide Sequence

>2623 : length: 1509
CCAAGGCCAGCCAGGACACCCCCTGGGATCACACTGAGCTTGCCACATCCCCAAGGCGGC
CGAACCCTCCGCAACCACCAGCCCAGGTTAATCCCCAGAGGCTCCATGGAGTTCCCTGGC
CTGGGGTCCCTGGGGACCTCAGAGCCCCTCCCCCAGTTTGTGGATCCTGCTCTGGTGTCC
TCCACACCAGAATCAGGGGTTTTCTTCCCCTCTGGGCCTGAGGGCTTGGATGCAGCAGCT
TCCTCCACTGCCCCGAGCACAGCCACCGCTGCAGCTGCGGCACTGGCCTACTACAGGGAC
GCTGAGGCCTACAGACACTCCCCAGTCTTTCAGGTGTACCCATTGCTCAACTGTATGGAG
GGGATCCCAGGGGGCTCACCATATGCCGGCTGGGCCTACGGCAAGACGGGGCTCTACCCT
GCCTCAACTGTGTGTCCCACCCGCGAGGACTCTCCTCCCCAGGCCGTGGAAGATCTGGAT
GGAAAAGGCAGCACCAGCTTCCTGGAGACTTTGAAGACAGAGCGGCTGAGCCCAGACCTC
CTGACCCTGGGACCTGCACTGCCTTCATCACTCCCTGTCCCCAATAGTGCTTATGGGGGC
CCTGACTTTTCCAGTACCTTCTTTTCTCCCACCGGGAGCCCCCTCAATTCAGCAGCCTAT
TCCTCTCCCAAGCTTCGTGGAACTCTCCCCCTGCCTCCCTGTGAGGCCAGGGAGTGTGTG
AACTGCGGAGCAACAGCCACTCCACTGTGGCGGAGGGACAGGACAGGCCACTACCTATGC
AACGCCTGCGGCCTCTATCACAAGATGAATGGGCAGAACAGGCCCCTCATCCGGCCCAAG
AAGCGCCTGATTGTCAGTAAACGGGCAGGTACTCAGTGCACCAACTGCCAGACGACCACC
ACGACACTGTGGCGGAGAAATGCCAGTGGGGATCCCGTGTGCAATGCCTGCGGCCTCTAC
TACAAGCTACACCAGCCTCCTTTTTGGCAGGTGAACCGGCCACTGACCATGCGGAAGGAT
GGTATTCAGACTCGAAACCGCAAGGCATCTGGAAAAGGGAAAAAGAAACGGGGCTCCAGT
CTGGGAGGCACAGGAGCAGCCGAAGGACCAGCTGGTGGCTTTATGGTGGTGGCTGGGGGC
AGCGGTAGCGGGAATTGTGGGGAGGTGGCTTCAGGCCTGACACTGGGCCCCCCAGGTACT
GCCCATCTCTACCAAGGCCTGGGCCCTGTGGTGCTGTCAGGGCCTGTTAGCCACCTCATG
CCTTTCCCTGGACCCCTACTGGGCTCACCCACGGGCTCCTTCCCCACAGGCCCCATGCCC
CCCACCACCAGCACTACTGTGGTGGCTCCGCTCAGCTCATGAGGGCACAGAGCATGGCCT
CCAGAGGAGGGGTGGTGTCCTTCTCCTCTTGTAGCCAGAATTCTGGACAACCCAAGTCTC
TGGGCCCCAGGCACCCCCTGGCTTGAACCTTCAAAGCTTTTGTAAAATAAAACCACCAAA
GTCCTGAAA

Protein Sequence

>2623 : length: 418
MEFPGLGSLGTSEPLPQFVDPALVSSTPESGVFFPSGPEGLDAAASSTAPSTATAAAAAL
AYYRDAEAYRHSPVFQVYPLLNCMEGIPGGSPYAGWAYGKTGLYPASTVCPTREDSPPQA
VEDLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPL
NSAAYSSPKLRGTLPLPPCEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRP
LIRPKKRLIVSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYYKLHQPPFWQVNRPL
TMRKDGIQTRNRKASGKGKKKRGSSLGGTGAAEGPAGGFMVVAGGSGSGNCGEVASGLTL
GPPGTAHLYQGLGPVVLSGPVSHLMPFPGPLLGSPTGSFPTGPMPPTTSTTVVAPLSS