ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

26173

Name

INTS1

Synonym

INT1|NET28;integrator complex subunit 1;INTS1;integrator complex subunit 1

Definition

-

Position

7p22.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

26173

Links to epithelial mesenchymal transition gene database

26173

Links to ovarian cancer gene database

26173

Links to endometrial cancer gene database

26173

Links to iHOP

26173

Sequence Information

Nucleotide Sequence

>26173 : length: 7004
GTTTCCGATTCCGGGGTGGCCGGGTGGCGGCGGCGGCGCTCCGGTCGCGATGGGCCAGAG
GTGACGCCGCAGCCGCCGGGAGCCGCGAGGGACGGGGCAGGATGAACCGGGCCAAGCCCA
CCACGGTGCGCCGGCCCAGCGCCGCGGCCAAACCCTCAGGGCACCCTCCCCCAGGAGACT
TCATTGCTCTGGGCTCAAAGGGTCAGGCCAATGAATCGAAAACGGCGTCCACCCTGCTGA
AGCCAGCCCCTTCCGGCCTGCCTTCTGAGCGCAAGCGGGATGCGGCGGCCGCGTTGTCCA
GTGCCTCGGCCCTCACCGGTCTCACCAAACGCCCCAAACTCTCCTCCACACCCCCTCTGA
GTGCCCTGGGGCGCCTGGCTGAGGCTGCAGTGGCAGAAAAACGAGCCATTTCTCCGTCGA
TTAAAGAGCCATCTGTGGTGCCAATTGAAGTGCTGCCCACGGTGCTGCTGGATGAGATCG
AGGCGGCCGAGCTGGAGGGCAACGATGACAGGATCGAGGGCGTGCTGTGCGGGGCCGTGA
AGCAGCTGAAGGTCACCCGCGCCAAGCCTGACAGCACCCTCTACCTGAGCCTCATGTACC
TGGCCAAGATCAAGCCCAACATCTTCGCCACTGAGGGCGTCATTGAGGCTCTGTGTAGCC
TCCTGCGGCGGGACGCCTCCATCAACTTCAAGGCCAAGGGGAACAGCCTGGTGTCTGTGC
TGGCCTGTAACCTCCTCATGGCCGCCTACGAGGAGGACGAGAACTGGCCCGAGATCTTTG
TCAAGGTGTACATCGAGGACTCCCTGGGGGAGCGGATCTGGGTGGACAGCCCTCACTGTA
AGACGTTTGTGGACAACATCCAGACGGCCTTCAACACCAGAATGCCCCCCAGGAGCGTGC
TGCTGCAGGGGGAGGCGGGCCGCGTTGCGGGCGACCTGGGTGCAGGGAGCAGCCCACACC
CCTCCCTCACGGAGGAGGAGGACAGCCAGACGGAGTTGCTGATCGCGGAGGAGAAGCTGA
GCCCCGAGCAGGAGGGCCAGCTCATGCCCAGGTACGAAGAGCTCGCGGAGAGCGTGGAGG
AGTATGTCCTGGACATGCTGCGGGACCAGCTGAACCGGCGCCAGCCCATCGACAACGTCT
CCAGGAACCTCCTGCGGCTCCTCACCTCCACCTGCGGCTATAAGGAGGTGCGGCTGCTGG
CGGTGCAGAAGCTGGAGATGTGGCTGCAGAACCCCAAGCTGACCCGGCCGGCCCAGGACC
TGCTGATGTCCGTCTGCATGAACTGCAACACGCACGGTTCCGAAGACATGGACGTCATCT
CACACCTGATCAAGATCCGCCTCAAGCCCAAGGTCCTCCTCAACCACTTCATGCTGTGCA
TCAGGGAGCTGCTGAGCGCGCACAAGGACAACCTGGGCACCACCATCAAGTTGGTGATCT
TCAATGAGCTCTCCAGCGCCCGGAACCCGAACAACATGCAGGTCCTCTATACCGCACTGC
AGCACAGCTCAGAGCTGGCGCCCAAGTTCCTGGCCATGGTGTTCCAGGACCTGCTGACCA
ACAAGGACGACTACCTGCGGGCCTCGCGGGCCCTGCTGCGGGAGATCATCAAGCAGACCA
AGCACGAGATCAACTTCCAGGCCTTCTGCCTGGGGCTCATGCAGGAGCGCAAGGAGCCGC
AGTACCTGGAGATGGAGTTCAAGGAGCGCTTCGTGGTGCACATCACCGACGTCCTGGCCG
TGTCCATGATGCTGGGCATCACAGCGCAGGTGAAGGAGGCCGGCATCGCCTGGGACAAAG
GAGAAAAGAGGAACCTGGAAGTGCTCCGCTCATTCCAGAACCAGATTGCCGCCATCCAGC
GGGATGCCGTCTGGTGGCTCCACACTGTGGTCCCCTCCATCAGCAAGCTCGCCCCTAAGG
ACTACGTGCACTGCCTGCACAAGGTGCTGTTCACAGAGCAGCCGGAGACCTACTACAAGT
GGGACAACTGGCCACCCGAGAGTGACCGCAACTTCTTCCTGCGTCTGTGCTCCGAGGTGC
CCATTTTGGAGGACACGCTGATGCGCATCCTGGTCATCGGGCTGTCCCGGGAGCTCCCGC
TCGGGCCTGCGGACGCCATGGAGCTTGCTGACCACCTGGTGAAGCGGGCGGCTGCCGTGC
AGGCGGATGATGTGGAGGTGCTGAAGGTGGGGAGGACCCAGCTGATCGACGCCGTTCTGA
ATCTGTGCACCTACCATCACCCTGAAAACATCCAGCTCCCACCGGGGTACCAGCCTCCGA
ACCTCGCCATCTCTACCCTCTACTGGAAGGCCTGGCCCCTCCTGCTGGTCGTCGCCGCAT
TCAACCCAGAGAACATCGGCCTGGCTGCGTGGGAGGAGTACCCGACCCTGAAGATGCTCA
TGGAGATGGTGATGACCAACAACTACTCCTACCCACCGTGCACCCTGACGGATGAGGAGA
CCCGGACGGAGATGCTGAACCGTGAGCTGCAGACCGCCCAGCGGGAGAAGCAGGAGATCC
TGGCCTTCGAGGGGCACCTGGCGGCCGCGTCCACCAAGCAGACCATCACTGAGAGCAGCA
GCCTCCTCCTGTCGCAGCTCACCAGCCTGGACCCCCAGGGGCCCCCCCGGAGGCCTCCCC
CTCACATCCTGGATCAAGTGAAAAGCCTCAACCAGTCCCTCCGCCTCGGGCACCTCTTGT
GCCGCAGCCGAAACCCTGACTTTCTCCTCCACATCATCCAGCGGCAGGCCTCCTCGCAGT
CCATGCCCTGGCTGGCGGACCTGGTACAGTCCAGCGAGGGCTCCCTGGACGTGCTGCCCG
TGCAGTGTCTGTGCGAGTTCCTGCTGCACGATGCTGTGGACGATGCTGCTTCCGGGGAGG
AGGACGACGAGGGCGAGAGCAAGGAGCAGAAGGCCAAGAAGCGGCAGAGGCAACAGAAGC
AGCGGCAGCTGCTGGGCCGCCTGCAGGACCTGCTACTGGGCCCGAAGGCTGATGAGCAGA
CCACGTGTGAGGTGCTGGACTACTTCTTGCGGCGCCTCGGCTCCTCCCAGGTGGCCTCCC
GCGTGCTGGCCATGAAGGGTTTGTCGCTGGTGCTTTCGGAGGGCAGCCTGCGGGACGGGG
AGGAGAAGGAGCCCCCCATGGAGGAGGATGTGGGGGACACAGATGTGCTGCAGGGCTATC
AGTGGCTGCTGCGGGACCTGCCTCGCCTGCCTCTGTTCGACAGCGTCAGGAGCACCACAG
CCCTGGCCCTGCAGCAGGCAATCCACATGGAGACTGATCCCCAGACCATCAGCGCCTACC
TGATCTACTTGTCCCAGCACACGCCTGTGGAGGAGCAGGCCCAGCACAGCGACCTGGCCC
TGGACGTGGCCCGGCTGGTCGTGGAGCGCTCCACCATCATGTCCCACCTCTTCTCGAAGC
TCTCCCCGAGTGCCGCGTCGGACGCCGTGCTGAGCGCTCTGTTGTCCATCTTCTCACGCT
ACGTGAGGCGCATGCGGCAGAGCAAGGAGGGCGAGGAGGTCTACAGCTGGTCGGAGTCTC
AGGACCAGGTCTTCCTACGCTGGAGCAGCGGGGAGACAGCCACCATGCACATCCTCGTGG
TCCATGCCATGGTGATCCTGCTGACGCTGGGCCCGCCTCGAGCCGACGACAGCGAGTTCC
AGGCGCTGCTGGACATCTGGTTTCCGGAGGAGAAGCCACTGCCCACCGCCTTCCTGGTGG
ACACATCGGAGGAGGCGCTGCTGCTTCCTGACTGGCTGAAGCTGCGCATGATCCGTTCTG
AGGTGCTCCGCCTGGTGGACGCCGCCCTGCAGGACCTGGAGCCGCAGCAGCTGCTGCTGT
TCGTGCAGTCGTTTGGCATCCCCGTGTCCAGCATGAGCAAACTCCTCCAGTTCCTGGACC
AGGCAGTGGCCCACGACCCCCAGACTCTGGAGCAGAACATCATGGACAAGAATTACATGG
CCCACCTGGTGGAGGTCCAGCATGAGCGCGGCGCCTCCGGAGGCCAGACTTTCCACTCCT
TGCTCACAGCCTCCCTGCCGCCCCGCCGAGACAGCACAGAGGCACCCAAACCAAAGAGCA
GCCCAGAGCAGCCCATAGGCCAGGGCCGGATTCGGGTGGGGACCCAGCTCCGGGTGCTGG
GCCCTGAGGACGACCTGGCTGGCATGTTCCTCCAGATTTTCCCGCTCAGCCCGGACCCTC
GGTGGCAGAGCTCCAGTCCCCGCCCCGTGGCCCTCGCCCTGCAGCAGGCCCTGGGCCAGG
AGCTGGCCCGCGTCGTCCAGGGCAGCCCCGAGGTGCCGGGCATCACGGTGCGTGTCCTGC
AGGCCCTCGCCACCCTGCTCAGCTCCCCACACGGCGGTGCCCTGGTGATGTCCATGCACC
GTAGCCACTTCCTGGCCTGCCCGCTGCTGCGCCAGCTCTGCCAGTACCAGCGCTGTGTGC
CACAGGACACCGGCTTCTCCTCGCTCTTCCTGAAGGTGCTCCTGCAGATGCTGCAGTGGC
TGGACAGCCCTGGCGTGGAGGGCGGGCCCCTGCGGGCACAGCTCAGGATGCTTGCCAGCC
AGGCCTCAGCCGGGCGCAGGCTCAGTGATGTGCGAGGGGGGCTCCTGCGCCTGGCCGAGG
CCCTGGCCTTCCGTCAGGACCTGGAGGTGGTCAGCTCCACCGTCCGTGCCGTCATCGCCA
CCCTGAGGTCTGGGGAGCAGTGCAGCGTGGAGCCGGACCTGATCAGCAAAGTCCTCCAGG
GGCTGATCGAGGTGAGGTCCCCCCACCTGGAGGAGCTGCTGACTGCATTCTTCTCTGCCA
CTGCGGATGCTGCCTCCCCGTTTCCAGCCTGTAAGCCCGTTGTGGTGGTGAGCTCCCTGC
TGCTGCAGGAGGAGGAGCCCCTGGCTGGGGGGAAGCCGGGTGCGGACGGTGGCAGCCTGG
AGGCCGTGCGGCTGGGGCCCTCGTCAGGCCTCCTAGTGGACTGGCTGGAAATGCTGGACC
CCGAGGTGGTCAGCAGCTGCCCCGACCTGCAGCTCAGGCTGCTCTTCTCCCGGAGGAAGG
GCAAAGGTCAGGCCCAGGTGCCCTCGTTCCGTCCCTACCTCCTGACCCTCTTCACGCATC
AGTCCAGCTGGCCCACACTGCACCAGTGCATCCGAGTCCTGCTGGGCAAGAGCCGGGAAC
AGAGGTTCGACCCCTCTGCCTCTCTGGACTTCCTCTGGGCCTGCATCCATGTTCCTCGCA
TCTGGCAGGGGCGGGACCAGCGCACCCCGCAGAAGCGGCGGGAGGAGCTGGTGCTGCGGG
TCCAGGGCCCGGAGCTCATCAGCCTGGTGGAGCTGATCCTGGCCGAGGCGGAGACGCGGA
GCCAGGACGGGGACACAGCCGCCTGCAGCCTCATCCAGGCCCGGCTGCCCCTGCTGCTCA
GCTGCTGCTGTGGGGACGATGAGAGTGTCAGGAAGGTGACGGAGCACCTGTCAGGCTGCA
TCCAGCAGTGGGGAGACAGCGTGCTGGGCAGGCGCTGCCGAGACCTTCTCCTGCAGCTCT
ACCTACAGCGGCCGGAGCTGCGGGTGCCCGTGCCTGAGGTCCTACTGCACAGCGAAGGGG
CTGCCAGCAGCAGCGTCTGCAAGCTGGACGGACTCATCCACCGCTTCATCACGCTCCTTG
CGGACACCAGCGACTCCCGGGCGTTGGAGAACCGAGGGGCGGATGCCAGCATGGCCTGCC
GGAAGCTGGCGGTGGCGCACCCGCTGCTGCTGCTCAGGCACCTGCCCATGATCGCGGCGC
TCCTGCACGGCCGCACCCACCTCAACTTCCAGGAGTTCCGGCAGCAGAACCACCTGAGCT
GCTTCCTGCACGTGCTGGGCCTGCTGGAGCTGCTGCAGCCGCACGTGTTCCGCAGCGAGC
ACCAGGGGGCGCTGTGGGACTGCCTTCTGTCCTTCATCCGCCTGCTGCTGAATTACAGGA
AGTCCTCCCGCCATCTGGCTGCCTTCATCAACAAGTTTGTGCAGTTCATCCATAAGTACA
TTACCTACAATGCCCCAGCAGCCATCTCCTTCCTGCAGAAGCACGCCGACCCGCTCCACG
ACCTGTCCTTCGACAACAGTGACCTGGTGATGCTGAAATCCCTCCTTGCAGGGCTCAGCC
TGCCCAGCAGGGACGACAGGACCGACCGAGGCCTGGACGAAGAGGGCGAGGAGGAGAGCT
CAGCCGGCTCCTTGCCCCTGGTCAGCGTCTCCCTGTTCACCCCTCTGACCGCGGCCGAGA
TGGCCCCCTACATGAAACGGCTTTCCCGGGGCCAAACGGTGGAGGGTGAGTCAGGCCCTG
CTTCACCCACGCCAGATCTGCTGGAGGTTCTGAGTGACATAGACGAGATGTCCCGGCGGA
GACCCGAGATCCTGAGCTTCTTCTCGACCAACCTGCAGCGGCTGATGAGCTCGGCCGAGG
AGTGTTGCCGCAACCTCGCCTTCAGCCTGGCCCTGCGCTCCATGCAGAACAGCCCCAGCA
TTGCAGCCGCTTTCCTGCCCACGTTCATGTACTGCCTGGGCAGCCAGGACTTTGAGGTGG
TGCAGACGGCCCTCCGGAACCTGCCTGAGTACGCTCTCCTGTGCCAAGAGCACGCGGCTG
TGCTGCTCCACCGGGCCTTCCTGGTGGGCATGTACGGCCAGATGGACCCCAGCGCGCAGA
TCTCCGAGGCCCTGAGGATCCTGCATATGGAGGCCGTGATGTGAGCCTGTGGCAGCCGAC
CCCCCTCCAAGCCCCGGCCCGTCCCGTCCCCGGGGATCCTCGAGGCAAAGCCCAGGAAGC
GTGGGCGTTGCTGGTCTGTCCGAGGAGGTGAGGGCGCCGAGCCCTGAGGCCAGGCAGGCC
CAGGAGCAATACTCCGAGCCCTGGGGTGGCTCCGGGCCGGCCGCTGGCATCAGGGGCCGT
CCAGCAAGCCCTCATTCACCTTCTGGGCCACAGCCCTGCCGCGGAGCGGCGGATCCCCCC
GGGCATGGCCTGGGCTGGTTTTGAATGAAACGACCTGAACTGTC

Protein Sequence

>26173 : length: 2200
MNRAKPTTVRRPSAAAKPSGHPPPGDFIALGSKGQANESKTASTLLKPAPSGLPSERKRD
AAAALSSASALTGLTKRPKLSSTPPLSALGRLAEAAVAEKRAISPSIKEPSVVPIEVLPT
VLLDEIEAAELEGNDDRIEGVLCGAVKQLKVTRAKPDSTLYLSLMYLAKIKPNIFATEGV
IEALCSLLRRDASINFKAKGNSLVSVLACNLLMAAYEEDENWPEIFVKVYIEDSLGERIW
VDSPHCKTFVDNIQTAFNTRMPPRSVLLQGEAGRVAGDLGAGSSPHPSLTEEEDSQTELL
IAEEKLSPEQEGQLMPRYEELAESVEEYVLDMLRDQLNRRQPIDNVSRNLLRLLTSTCGY
KEVRLLAVQKLEMWLQNPKLTRPAQDLLMSVCMNCNTHGSEDMDVISHLIKIRLKPKVLL
NHFMLCIRELLSAHKDNLGTTIKLVIFNELSSARNPNNMQVLYTALQHSSELAPKFLAMV
FQDLLTNKDDYLRASRALLREIIKQTKHEINFQAFCLGLMQERKEPQYLEMEFKERFVVH
ITDVLAVSMMLGITAQVKEAGIAWDKGEKRNLEVLRSFQNQIAAIQRDAVWWLHTVVPSI
SKLAPKDYVHCLHKVLFTEQPETYYKWDNWPPESDRNFFLRLCSEVPILEDTLMRILVIG
LSRELPLGPADAMELADHLVKRAAAVQADDVEVLKVGRTQLIDAVLNLCTYHHPENIQLP
PGYQPPNLAISTLYWKAWPLLLVVAAFNPENIGLAAWEEYPTLKMLMEMVMTNNYSYPPC
TLTDEETRTEMLNRELQTAQREKQEILAFEGHLAAASTKQTITESSSLLLSQLTSLDPQG
PPRRPPPHILDQVKSLNQSLRLGHLLCRSRNPDFLLHIIQRQASSQSMPWLADLVQSSEG
SLDVLPVQCLCEFLLHDAVDDAASGEEDDEGESKEQKAKKRQRQQKQRQLLGRLQDLLLG
PKADEQTTCEVLDYFLRRLGSSQVASRVLAMKGLSLVLSEGSLRDGEEKEPPMEEDVGDT
DVLQGYQWLLRDLPRLPLFDSVRSTTALALQQAIHMETDPQTISAYLIYLSQHTPVEEQA
QHSDLALDVARLVVERSTIMSHLFSKLSPSAASDAVLSALLSIFSRYVRRMRQSKEGEEV
YSWSESQDQVFLRWSSGETATMHILVVHAMVILLTLGPPRADDSEFQALLDIWFPEEKPL
PTAFLVDTSEEALLLPDWLKLRMIRSEVLRLVDAALQDLEPQQLLLFVQSFGIPVSSMSK
LLQFLDQAVAHDPQTLEQNIMDKNYMAHLVEVQHERGASGGQTFHSLLTASLPPRRDSTE
APKPKSSPEQPIGQGRIRVGTQLRVLGPEDDLAGMFLQIFPLSPDPRWQSSSPRPVALAL
QQALGQELARVVQGSPEVPGITVRVLQALATLLSSPHGGALVMSMHRSHFLACPLLRQLC
QYQRCVPQDTGFSSLFLKVLLQMLQWLDSPGVEGGPLRAQLRMLASQASAGRRLSDVRGG
LLRLAEALAFRQDLEVVSSTVRAVIATLRSGEQCSVEPDLISKVLQGLIEVRSPHLEELL
TAFFSATADAASPFPACKPVVVVSSLLLQEEEPLAGGKPGADGGSLEAVRLGPSSGLLVD
WLEMLDPEVVSSCPDLQLRLLFSRRKGKGQAQVPSFRPYLLTLFTHQSSWPTLHQCIRVL
LGKSREQRFDPSASLDFLWACIHVPRIWQGRDQRTPQKRREELVLRVQGPELISLVELIL
AEAETRSQDGDTAACSLIQARLPLLLSCCCGDDESVRKVTEHLSGCIQQWGDSVLGRRCR
DLLLQLYLQRPELRVPVPEVLLHSEGAASSSVCKLDGLIHRFITLLADTSDSRALENRGA
DASMACRKLAVAHPLLLLRHLPMIAALLHGRTHLNFQEFRQQNHLSCFLHVLGLLELLQP
HVFRSEHQGALWDCLLSFIRLLLNYRKSSRHLAAFINKFVQFIHKYITYNAPAAISFLQK
HADPLHDLSFDNSDLVMLKSLLAGLSLPSRDDRTDRGLDEEGEEESSAGSLPLVSVSLFT
PLTAAEMAPYMKRLSRGQTVEGESGPASPTPDLLEVLSDIDEMSRRRPEILSFFSTNLQR
LMSSAEECCRNLAFSLALRSMQNSPSIAAAFLPTFMYCLGSQDFEVVQTALRNLPEYALL
CQEHAAVLLHRAFLVGMYGQMDPSAQISEALRILHMEAVM