ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

26040

Name

SETBP1

Synonym

MRD29|SEB;SET binding protein 1;SETBP1;SET binding protein 1

Definition

SET-binding protein

Position

18q21.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

26040

Links to epithelial mesenchymal transition gene database

26040

Links to ovarian cancer gene database

26040

Links to endometrial cancer gene database

26040

Links to iHOP

26040

Sequence Information

Nucleotide Sequence

>26040 : length: 9899
GGTTAAGTGGAGCTAGAGAGCTACATTGTAACCTAGTTGGATTTTTTTGGGGGGGGAATG
TATCAGAATCTAACGTGTCGTTAATAGAAAGAAGAACAGGCAAGAAGTGGTCCAGCCGGC
GAAGTTGCAGATCTGATCTCTTCTGAACACCTCATCGTGTCTCCATCCCTGGGAATCTGA
CCCTAGCAACTGGACCACTTTGTTCTTGGAATTTTGGGTGTCCTCTTTTCTCACCTTTCC
CTTTTCCCTTTTCCCCTTCCCCCTCCTGAGAACTCCGGAAGACTGTAGAGATTGTCATGG
AGTCCAGGGAAACCTTAAGCAGCTCCCGGCAAAGAGGGGGCGAGTCAGACTTCCTGCCGG
TCTCCTCAGCCAAGCCCCCAGCTGCTCCTGGCTGTGCAGGAGAACCTTTGCTCTCCACTC
CAGGACCTGGGAAGGGGATCCCGGTGGGCGGAGAGCGCATGGAGCCAGAGGAGGAGGATG
AACTAGGCTCAGGGCGGGATGTGGATTCCAACTCCAACGCGGACAGTGAGAAATGGGTGG
CAGGAGATGGTTTGGAAGAGCAGGAATTTTCTATCAAGGAGGCAAACTTCACAGAGGGAA
GTCTGAAGCTAAAGATTCAGACCACAAAGCGGGCTAAGAAACCCCCAAAGAATTTGGAGA
ACTATATATGTCCACCTGAGATCAAGATCACCATCAAGCAGTCTGGGGACCAGAAGGTGT
CCCGTGCTGGAAAAAATAGCAAAGCCACGAAGGAGGAAGAAAGAAGCCACTCCAAAAAGA
AGCTCCTCACAGCCAGTGACCTTGCAGCCAGTGACCTCAAAGGATTTCAGCCACAGGCTT
ACGAGAGGCCCCAGAAACATTCAACTCTCCATTATGACACGGGCCTCCCACAGGACTTCA
CCGGTGACACCTTAAAACCAAAGCACCAGCAAAAAAGCAGCAGCCAGAACCACATGGACT
GGTCCACCAACTCTGACAGCGGACCCGTCACTCAGAATTGCTTCATCAGTCCAGAGTCTG
GCAGAGAAACTGCAAGCACCAGCAAGATCCCCGCTCTTGAGCCCGTGGCTTCCTTTGCAA
AGGCCCAGGGTAAGAAAGGCAGTGCAGGGAACACGTGGAGTCAGTTGTCTAACAATAACA
AAGATCTGCTCTTGGGAGGTGTGGCTCCATCCCCAAGCAGCCACAGCTCACCAGCCCCAC
CCAGCAGCTCTGCTGAGTGCAACGGGCTTCAGCCCTTGGTGGATCAAGATGGAGGAGGTA
CAAAGGAGCCCCCAGAACCACCTACGGTGGGCAGCAAGAAAAAGTCCAGTAAAAAAGATG
TGATAAGTCAGACCATACCAAACCCAGACCTGGATTGGGTCAAGAATGCCCAGAAAGCAT
TTGACAATACAGAAGGGAAAAGGGAAGGTTATTCCGCAGATAGTGCCCAAGAGGCATCAC
CAGCCAGGCAGAACGTGAGTTCTGCCAGTAATCCTGAAAATGACTCAAGTCATGTCCGGA
TTACTATCCCCATCAAGGCACCCTCTCTGGATCCAACCAACCATAAGAGGAAAAAAAGAC
AGTCCATTAAAGCGGTGGTGGAAAAGATCATGCCAGAGAAAGCCTTGGCTTCTGGAATCA
CCATGAGCAGTGAAGTAGTTAACAGGATACTTTCCAACTCTGAGGGGAATAAGAAGGATC
CCCGTGTCCCTAAGTTGAGTAAAATGATAGAGAATGAGTCCCCCTCAGTTGGCCTTGAAA
CTGGTGGAAATGCTGAGAAAGTTATCCCAGGAGGTGTGTCTAAGCCGCGGAAGCCACCCA
TGGTCATGACACCTCCAACGTGCACAGATCACTCTCCATCCAGAAAGCTGCCAGAAATCC
AGCATCCAAAATTTGCTGCAAAACGAAGGTGGACTTGCAGCAAACCAAAACCTAGCACCA
TGCTTCGAGAGGCAGTTATGGCCACCTCTGATAAACTGATGCTGGAGCCCCCGTCTGCAT
ATCCCATCACCCCATCCAGCCCTCTCTACACCAACACAGACAGTCTTACTGTGATCACTC
CAGTCAAAAAGAAGCGGGGACGACCAAAGAAGCAGCCTTTGCTCACAGTCGAGACGATTC
ATGAGGGAACTTCCACCAGCCCCGTCAGTCCCATCAGCCGAGAGTTTCCTGGCACTAAGA
AAAGAAAGCGACGACGCAATTTAGCGAAGTTGGCCCAGCTAGTGCCGGGAGAGGACAAAC
CCATGAGCGAGATGAAATTTCACAAGAAAGTTGGAAAGCTCGGCGTGTTGGATAAGAAGA
CCATCAAAACTATCAATAAGATGAAGACACTCAAGAGGAAAAACATCTTGAATCAGATCT
TGTCCTGTTCCAGCAGCGTTGCTCTGAAGGCAAAAGCTCCCCCAGAGACCAGCCCTGGGG
CAGCAGCCATTGAAAGCAAACTGGGCAAGCAGATTAATGTCAGCAAGAGGGGAACCATCT
ACATTGGCAAGAAGCGGGGCAGGAAGCCAAGAGCAGAGCTGCCACCCCCATCCGAAGAAC
CCAAAACAGCCATCAAGCACCCCAGGCCTGTTTCTAGCCAGCCGGATGTTCCAGCCGTGC
CTTCCAACTTTCAGTCACTTGTGGCGTCTTCACCAGCAGCTATGCACCCACTTTCAACAC
AGTTAGGTGGGTCCAATGGCAACCTGAGCCCTGCCAGCACTGAAACCAATTTTTCAGAGT
TGAAAACTATGCCAAATCTCCAGCCCATCAGTGCTCTTCCAACCAAAACCCAAAAGGGAA
TACACAGTGGAACCTGGAAGCTGTCTCCACCCAGACTGATGGCCAACTCCCCTTCACACC
TGTGCGAGATTGGCTCCCTAAAGGAAATCACGCTGTCCCCTGTGAGCGAGTCCCACAGTG
AGGAGACGATCCCCAGCGACAGCGGCATTGGGACAGACAACAACAGCACTTCTGACCAAG
CGGAGAAGAGCTCAGAATCCCGAAGGAGGTACTCTTTTGATTTCTGCTCCCTGGACAACC
CGGAGGCCATTCCGTCCGACACCAGCACAAAGAACCGGCATGGCCACCGGCAAAAGCATC
TCATTGTGGACAACTTTCTGGCCCACGAAAGCCTCAAGAAGCCAAAGCACAAGAGGAAAC
GGAAAAGCCTGCAAAACCGCGATGACCTCCAGTTTCTGGCAGACCTGGAGGAGCTAATCA
CCAAGTTCCAAGTGTTCAGAATCTCCCACCGGAGTTACACCTTCTACCACGAGAATCCAT
ATCCCAGCATTTTTCGGATTAATTTTGATCACTATTACCCGGTGCCATATATCCAGTATG
ACCCGTTGCTCTATCTTCGTAGGACTTCAGACTTGAAGTCAAAGAAGAAGCGTGGTAGGC
CTGCAAAAACCAATGACACCATGACAAAGGTGCCTTTTTTACAAGGGTTCAGCTACCCTA
TTCCCAGTGGAAGTTACTATGCACCCTATGGAATGCCTTACACATCAATGCCTATGATGA
ACCTTGGTTATTACGGTCAGTACCCAGCTCCTTTGTACCTATCGCACACGCTTGGAGCAG
CTTCCCCATTCATGAGGCCAACAGTGCCACCACCTCAGTTCCACACAAACTCCCACGTAA
AGATGTCCGGTGCAGCTAAGCATAAAGCCAAGCATGGAGTACACCTGCAGGGACCTGTTA
GCATGGGCCTTGGTGACATGCAGCCTTCTCTGAACCCTCCCAAGGTAGGCAGTGCCAGTC
TGTCCAGTGGTCGGCTCCATAAGAGGAAACACAAACACAAGCATAAGCACAAGGAAGACC
GGATCCTAGGGACCCATGACAACCTGAGTGGTCTTTTTGCAGGCAAAGCCACAGGCTTCT
CCAGCCACATCCTGAGCGAGCGGCTGAGTAGCGCAGACAAAGAGCTCCCGCTGGTGAGTG
AGAAGAACAAGCATAAGGAGAAACAGAAGCACCAGCACAGCGAAGCCGGCCACAAAGCTT
CTAAGAACAACTTTGAGGTGGACACCCTGTCTACACTGTCACTTTCCGACGCCCAGCATT
GGACACAGGCCAAGGAAAAAGGAGACTTGAGCAGTGAGCCTGTGGACTCATGCACGAAAA
GATACTCTGGCAGTGGCGGGGATGGTGGCAGCACGAGATCAGAGAACCTGGACGTGTTCA
GTGAAATGAACCCTTCGAATGACAAGTGGGACAGTGACGTGAGTGGGAGTAAAAGGAGGA
GCTATGAAGGCTTTGGAACGTACAGGGAAAAGGACATCCAAGCCTTCAAGATGAACCGCA
AGGAGAGAAGTTCTTATGACTCCTCCATGTCTCCAGGGATGCCAAGTCCCCACTTAAAAG
TGGACCAGACAGCAGTGCATAGTAAGAACGAAGGCTCAGTGCCCACCATGATGACCAGGA
AGAAGCCAGCCGCAGTTGACAGTGTTACAATTCCACCAGCCCCAGTGTTATCTCTCCTTG
CTGCATCTGCAGCAACGTCGGATGCAGTCGGCTCCTCCCTGAAGAAGAGGTTCAAGCGGC
GGGAGATCGAAGCCATCCAGTGCGAAGTGCGGAAGATGTGCAACTACACCAAGATCCTGT
CCACCAAGAAGAACCTGGACCACGTGAACAAGATCCTGAAGGCCAAGCGGCTGCAGAGAC
AATCAAAAACAGGCAACAACTTCGTGAAGAAGAGGCGCGGGCGTCCCAGGAAGCAGCCCA
CCCAGTTCGATGAGGACTCCAGAGACCAAATGCCGGTGCTGGAAAAATGCATCGACCTGC
CCAGCAAAAGAGGCCAGAAGCCCAGCCTGAGCCCGCTGGTGCTGGAGCCCGCCGCCAGCC
AAGACACCATCATGGCCACCATCGAGGCGGTCATCCACATGGCCCGGGAGGCGCCGCCCC
TGCCCCCGCCACCGCCGCCGCCCCTGCCGCCACCGCCGCCACCACCCCTGCCCCCGCCAC
CCCCTCTACCCAAGACCCCCCGAGGCGGAAAGAGGAAACACAAACCGCAGGCCCCCGCTC
AGCCCCCACAGCAGTCGCCCCCGCAGCAGCCCCTTCCCCAGGAAGAGGAGGTGAAAGCCA
AAAGGCAGAGGAAGTCCCGAGGGAGTGAGAGCGAGGTCCTTCCCTAGGGCGGGTCTGGGC
GTCTGCACCTGGGGCCTAGGGAACTGACACGTGGGAAGCGCAGTGAGCCGGGGCGGGGGC
GGAATCCCCCGCTGCAGGGACACCCACGCCCTTCTCTCCAGAAGCCGGGCAGGCAGAATC
CGGCCAGACGACGGGGCTGAGCCATCAGGAGCTCTTGGGAAAGCAAAGCAGGGAGACACC
TTCAGAAGAAGCTTGTCTGAGCTTCACCGCAGCTCCCACCACGCGGCGCTTCAGTACGGC
TGGATCCTCCGCAGGCGAGCGGAAGGCCCCCAGGAGGAGCAGGCTGGTGGCACTCTCCTG
ACCTCACGCTGCCAAGGTGCGCCCTCGACTCCCGATTTCATTTGCTGGCCAGGAAAATCG
AAAGGGAAACACCCTCAATTAGGAAACATTCCAAGGGGAGAAAAGCTGCAAATTGCTCAA
CTGGCATTGCTGTAACCCGTTCCATTTAATTGGTTTTTATTTCTTTTGATTTTCAAGCTC
TGCTAAGCTTTGGGGTACCAACGTCATCTTCAGGTGACCTGAATCTTTCCCTTAACCGTA
CAGTTTCTCGATGGAATTGTGTGATCAGAAGGTGGAATTCTAGTGATAGGCGACCTCAGA
CCCGCATTCATGTTCTGTGTGCCTCTTCTATTGCACATACACTGATTTTTAGCATTGTCT
ATTCCTATTTTTCCTTTGCCCATTGTACTTCCATATATCTTTTCATTAACTTACTTGCTG
CCTTTTTTTTTTCTTGGTACACATTTAAATAAAGTAATCCTTAACCTGTGCTGTAAAGTT
CACCCTTGGCATGCTGTTCCAAGAACCTGGGTTTGAATCCCAATCGTTGTGAAACATACT
CAGTATTGATAAAACCTTTTTAATAAGTGATGCAGAGCAGCCAAGGATATGTTGACCCAG
ATGTCAACCAGGCTATTTTTATACTTAAAACATGTCAGCAGAGCATAGGCAGAATAAAAT
GGTTTAAATACCCCACAGCAAATAGAGTAACTGACAAACCACCAAAAACTGAAACCCCAG
ACCCACCAGAAAGACAAGTGTCTAGCAATGCCTTGGTACCTGATCTTTTTCATTCAAATA
ATTGTCATAGGTTGTTCAAAAAAAAAAAAAAAAAGGAAACAAAAACACAATAGAAGTCCA
TTATCCCTTGATAATTATTTCTTAAAAGCAAATGGGAGTAAGTGTTCTTATCTGGAAAAA
TAAATAAATAAAATGCTCAAAGGGTATCACCACTTCAATTTTATCAAGCCACCTTGGACA
AAGTATCCAAATTGTGGTTGCCTTAATAAACTAAAACATTATTGTACATAATGTAATTAT
AAATCTATCAGTCTGCATGGATGCAAACTGTGTGTGACAAATCGTCTTTTAAATGGTCAA
TTTCAGCTGTACATTTCTCATCCAAGTTGTACTCTAGCCATTGGTTTAGCGTGGACAGAT
ACTCCATCTCTATTATCCATTTCCACAGCCCAAATAAAATATGTTAAGCAGGCTCAGAAT
GAATATGAAGAATTCCATTTCCGTAGATGTTTTCTAAAAGTCAGATTGTGGAAATTTCAA
ATAAGTATTTTCAATTTCCTCCCTCACTCCCTCTTACCTTCCCCAAGACATCAAACACCT
GGCATGGTAGATTATAGAAAGAGACACTGAGAGAGAGAATTAAATTTTCTAATGGGAATT
AGAATATCTGGTTTACCTCCAAATTAAGTTTCTTTACAGGAAGTTGGGACCAGCTGGAAA
TTGTATTATCATTTCGGAACACAATATTACTTCCTTAGAGAGAGATGGATTTTTGTTGGC
AACATAAAAGAATAAGTGATGGGGTATCTATGTGAGTAAATTTTTAAATTCCAAGTTAAT
ATGCTTGCAAACATTACTGCTGCGTTATGGCACCAAGAGTTGGTTGAAATTACCCACGTA
GTCATACTCCTGTGCTCTGTCACCATGGACTTCACATCATTTGCTGCCCACTAGTTCAAT
CGCATTTAATCCTAGCAATATGTAAGTTTAAAGGACTGCATTCCCCTCTACTTTAAAGCT
TATATCCTAGATACTCAGTTTGTGACCTTGGTTGACCTTTGGCATTTCACGCAAGTTGAA
CAGCAAAATCAAAGCAGCCATTTTTAATTCGTCATTCCCAAGCCCTATCTGAGTGGTTCC
AAAGTCACCTGAGAGGAAGGTTTAAATTAGTCCCTCTCACCCCACCATTGCTATAAAACA
GCAACGTTTTCATTCCAATTCAGCCATAAAGAGGTTTCTCTTCTTACTGGGTTTTGAAAT
CATTTCCTTTTTTCTTTCGTTTGCCCTTCTTCCTTCCTGTGTTGTACTATCTCTCCAACC
ACGTCTATAAGCAGACTCAATCTTCTTGCAGAGGAAGATGAGCTGGCACTCTGCAAACTT
CTTTAATAAGGACCCAAAGTTTACTTGACATTAACCTCTAGTAGGTGAGAAATTCCAAAA
AAGCTTTGGGGTACATTAGAATTTCCAAAGCTCTGAAAGATATTTCAGGAGATTTAACAG
CAGAGTTGCAACTTACACGTGAATTCTGGTCTATAGTGGTCATGTGAGTTAAATTCGAAT
CCTCTACTTGTATGACCCTAGGAATAGATTGGAATACTGCAGAGGACCAAAGCTGAGGCA
TGCTAAACAGCTGCTTGGAGGTGGAAGCAAGTTCAGTCACCTACTCAGCTTCCTCTCTCC
ACCACCCAGTTCCTCCCTCAGTATCACATTATTTTTTTCTTCTGCTTTTCATTAACCTAA
CTCATCTCATCAGTACAACCATTTTCTTATTCTCTAACTACCCCCAATTCCTTTAGCCTC
TCCCCACCTGTCCAAACTCAGCTCAGCCGTGGGCCAATGCAGCTTACAGACGGTTGCAGA
GCTAGGAAGAAAACCCAGCTCTCCCAACCCTGATCGTGGAGGTCTCTGGCCCCCCAACAC
TGCCTTCTGGGGGCTGCATTTTTTTTTTTTTTTTGAGAAGAGGTCTTTTGGGATGCATGG
TGCTCCACATACAGCTTCACAAAATATTTCATTATAAGAGAAACCCCTTGATTTTTATTT
CTTTTTCTTTTGTTTTCTGGATTACCTGCCTTCAGTAAGCAGATGCAGACCCACTTGTAA
GGAGTCTGGTTAGTGATGAGAAAAGGATGAAATCTAGATACAAAAGTCACCTTGAAGGTG
ATGATGGATCTTTAATCCACTTGACTAAGTGTCTGGAAGAGCTACTTGCTCTTCCACCCC
TCATCTCAAATGAGAGGAGCAGAAGTTTAACTTCCTCAAATAGCCCAGCTCTGGCTAAAA
CCCAAAGAAGAAAGGTCAAAGGAAGGGAAAGCATGTCAGGGGCTGGTTTGTGACTTGGCA
GGACCAGGAAACAGCAGCCACTGACAGCCCAGAGAAGGTGACTAAGGGCTGGCAGAAGAT
TAGAATGTTAATTTGGCTGCTGTCCGGACTAGGAGGCCATGTTCAATGGCAGTCAGAATT
TGTGTTCTGCGCATTGCTGGGTCTATAAATATGATAAGCAAGTGGTGACAGAATTATAGT
ATAAGGTGATGTACTACATGCAGATCATAAAGGCTTTGGTTTTAAGACTTAAGTAGAAAA
TCCCTCTCCTAGCTTATTACCCAACAATATTCAGATAATGAGCTTTTGGAGAATATCTTT
TTCCTATCACTAGAAAGATTTACCTGGGAACTGTCTAAAGTCTACACACATATTTCCAAA
GCCTTTAAATACCAACTGCAGCATGGAGAGAGAGGGGTGGCAGAAGCTGAAATGCCTCAA
AAGCCATTTAAGTGTTACGTTGCAGGATTTTCAGTCCTTCTCGTTATGTAAAAGTAGATA
AATATAGACGTTATTCTCAACACTACCCTATAGTATCACAGTGGTCCAAATGCCAGAGCT
TACAGATAATGTCATCACAGTGCCTAGAAACTCGAACTGTAATATATCGTAGCATTTTCT
TGGTGTTTCTTAAAGTTTCTTTCCACAATACAAGGTCCTCTCTGCCTCTTGTTTCTTGGA
GAGTTCACCCCACTGATGAGTCTTCCTTCCCTGTTGGACTCAGTCATTTGGGGAACAGTC
TTAGAAGCACATATCAACCAAGGAAGAAACTTCCTGGATATCTATTGCCCACTTGCCCAG
GTCTAATAAACACTAAAGGGGGGAAATTGAAAGGAGCTGCCAACTGGTCAACGTGGAAGG
GCGGTTCCACCCTAGATTGGTGTCTTTCTTTTTCTTCCTTTTTTTAAAAAAAATCTATTT
CTTAAATAATAATAAATGCACATGATGTGTTAAATATGTACATATATATTTCAAAAGAAA
AAATGGGGCACAAGATTGTCTTACAAGTCGTGCTGGCTAATTTTTAGTTTGTATTCATAA
GTGGTTTTTAAAAGCCTTTTTTAAAGTGTAATTTGCATGTTCTACTTTGATTGTATGTAA
ACATATTTTAGAACAAAAAATGTATTTGTATTTTATTGAATATAGAGGCAAGAAAATTGT
ACATTGTTTGAAATGTTCTTTTTGTAACAGTTTTTATTCATAAAGCATTTTTGTACATTT
AAAATGAACATGGACTTGCTGTTATTTGAGGCGTAGATACATCTAGCATGCTTACTGTCA
TGCTCCTCCATGGTCTTAGATGTTGGGTTTTAAACATTTTTTTCTAAAAGAAAGCTCAGT
CTTTTCCGCTACCAGATCAGGTTAGCACAGTATAGAGCACTTAACTATTAAAAAAAAAAA
GTTAATCCTATTCATATGTTATTCATTGTGTGAAATTAAAGACATTCAATTCAGTCTAA

Protein Sequence

>26040 : length: 1596
MESRETLSSSRQRGGESDFLPVSSAKPPAAPGCAGEPLLSTPGPGKGIPVGGERMEPEEE
DELGSGRDVDSNSNADSEKWVAGDGLEEQEFSIKEANFTEGSLKLKIQTTKRAKKPPKNL
ENYICPPEIKITIKQSGDQKVSRAGKNSKATKEEERSHSKKKLLTASDLAASDLKGFQPQ
AYERPQKHSTLHYDTGLPQDFTGDTLKPKHQQKSSSQNHMDWSTNSDSGPVTQNCFISPE
SGRETASTSKIPALEPVASFAKAQGKKGSAGNTWSQLSNNNKDLLLGGVAPSPSSHSSPA
PPSSSAECNGLQPLVDQDGGGTKEPPEPPTVGSKKKSSKKDVISQTIPNPDLDWVKNAQK
AFDNTEGKREGYSADSAQEASPARQNVSSASNPENDSSHVRITIPIKAPSLDPTNHKRKK
RQSIKAVVEKIMPEKALASGITMSSEVVNRILSNSEGNKKDPRVPKLSKMIENESPSVGL
ETGGNAEKVIPGGVSKPRKPPMVMTPPTCTDHSPSRKLPEIQHPKFAAKRRWTCSKPKPS
TMLREAVMATSDKLMLEPPSAYPITPSSPLYTNTDSLTVITPVKKKRGRPKKQPLLTVET
IHEGTSTSPVSPISREFPGTKKRKRRRNLAKLAQLVPGEDKPMSEMKFHKKVGKLGVLDK
KTIKTINKMKTLKRKNILNQILSCSSSVALKAKAPPETSPGAAAIESKLGKQINVSKRGT
IYIGKKRGRKPRAELPPPSEEPKTAIKHPRPVSSQPDVPAVPSNFQSLVASSPAAMHPLS
TQLGGSNGNLSPASTETNFSELKTMPNLQPISALPTKTQKGIHSGTWKLSPPRLMANSPS
HLCEIGSLKEITLSPVSESHSEETIPSDSGIGTDNNSTSDQAEKSSESRRRYSFDFCSLD
NPEAIPSDTSTKNRHGHRQKHLIVDNFLAHESLKKPKHKRKRKSLQNRDDLQFLADLEEL
ITKFQVFRISHRSYTFYHENPYPSIFRINFDHYYPVPYIQYDPLLYLRRTSDLKSKKKRG
RPAKTNDTMTKVPFLQGFSYPIPSGSYYAPYGMPYTSMPMMNLGYYGQYPAPLYLSHTLG
AASPFMRPTVPPPQFHTNSHVKMSGAAKHKAKHGVHLQGPVSMGLGDMQPSLNPPKVGSA
SLSSGRLHKRKHKHKHKHKEDRILGTHDNLSGLFAGKATGFSSHILSERLSSADKELPLV
SEKNKHKEKQKHQHSEAGHKASKNNFEVDTLSTLSLSDAQHWTQAKEKGDLSSEPVDSCT
KRYSGSGGDGGSTRSENLDVFSEMNPSNDKWDSDVSGSKRRSYEGFGTYREKDIQAFKMN
RKERSSYDSSMSPGMPSPHLKVDQTAVHSKNEGSVPTMMTRKKPAAVDSVTIPPAPVLSL
LAASAATSDAVGSSLKKRFKRREIEAIQCEVRKMCNYTKILSTKKNLDHVNKILKAKRLQ
RQSKTGNNFVKKRRGRPRKQPTQFDEDSRDQMPVLEKCIDLPSKRGQKPSLSPLVLEPAA
SQDTIMATIEAVIHMAREAPPLPPPPPPPLPPPPPPPLPPPPPLPKTPRGGKRKHKPQAP
AQPPQQSPPQQPLPQEEEVKAKRQRKSRGSESEVLP