ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

25937

Name

WWTR1

Synonym

TAZ;WW domain containing transcription regulator 1;WWTR1;WW domain containing transcription regulator 1

Definition

WW domain-containing transcription regulator protein 1|transcriptional co-activator with PDZ-binding motif|transcriptional coactivator with PDZ-binding motif

Position

3q23-q24

Gene Type

protein-coding

External Links

Links to cell senescence gene database

25937

Links to epithelial mesenchymal transition gene database

25937

Links to ovarian cancer gene database

25937

Links to endometrial cancer gene database

25937

Links to iHOP

25937

Sequence Information

Nucleotide Sequence

>25937 : length: 5702
CGGCCCTTCCTAGGCCTGAGCCCCTCATCCGCGTGCCCTCCGCCACCCCCGGCCTTGGTT
TCGGTCCACAACCCCTTGATGAAACAGGCTCAGGCCACTTTCCCTTTGATCCCGCCCCAA
GTCCGTGGTAAACTCAAAGGAATGCAGATGCAGGTCTGAGCGGGAGAGGTCCGCGCGGCC
GGGAGGAGTGGGTGGGGGGCACCCGTCTCCTCTTACCCAGTAAAGTACCCATCACGCCCA
GGGTTTTCTGGAGCCGAGGTGGGAGGAGGAGGAGGAGGAAGAGGAGGGGCGAGCGGGGGC
TGGCCGGCTAGGGACTAGGAGGTCATACATAATTCAACAGCTCAACTTTCGGGCCCGCCT
CTTTCCTGGGGGTGGGAGTTTGCTCCAAACTTTGTTTATGGGACAGTCCGGGAGCTGCTG
CGGCCGCGCTGTCTGCTTCTCCTGCGCCTCCTTTTCGCCCAGCACTAGCGCCTTAGGCCA
GCTCGGGGGATGTGAGAGCCGAAGCCCTTAGACTGCCAGGCACAGAGTCGGGTCGGGATT
TGTCAGCCAAGCCTCGGCTCCAGCTCCGCAATCTCGGGACTCACCCGAGCGACCCAGGCC
CGACGGCAAGTTCGGGCGGGACGGCGGCCGCCGCGCGCTCAGGCTCAGCTTCGCTGCCCG
CCCAGGTAGTGCCCGCTGGAGCTCGCGCGCTCATCCGGCACCACTCCAGGGCTCCAGGCT
CCTCGGGCTTCCGGAGTCGAGACGTGGTGGAGTTGGCTCGGGCTGAACTTCTTTCGGGGG
GCTGCCTGTCCTGGAATCGTGCGACCTTTCCTTTGCCATCCTGCGGTTCAGCAAGCCCCG
AGTGCAGTTATTCCCTCCACCCCTCGCCCTATCTTCTCCTCCTCCAGGCAACTTCTTTGC
TTCAAGAAAGTTGCATAATTCTCGAGAAGATGAATCCGGCCTCGGCGCCCCCTCCGCTCC
CGCCGCCTGGGCAGCAAGTGATCCACGTCACGCAGGACCTAGACACAGACCTCGAAGCCC
TCTTCAACTCTGTCATGAATCCGAAGCCTAGCTCGTGGCGGAAGAAGATCCTGCCGGAGT
CTTTCTTTAAGGAGCCTGATTCGGGCTCGCACTCGCGCCAGTCCAGCACCGACTCGTCGG
GCGGCCACCCGGGGCCTCGACTGGCTGGGGGTGCCCAGCATGTCCGCTCGCACTCGTCGC
CCGCGTCCCTGCAGCTGGGCACCGGCGCGGGTGCTGCGGGTAGCCCCGCGCAGCAGCACG
CGCACCTCCGCCAGCAGTCCTACGACGTGACCGACGAGCTGCCACTGCCCCCGGGCTGGG
AGATGACCTTCACGGCCACTGGCCAGAGGTACTTCCTCAATCACATAGAAAAAATCACCA
CATGGCAAGACCCTAGGAAGGCGATGAATCAGCCTCTGAATCATATGAACCTCCACCCTG
CCGTCAGTTCCACACCAGTGCCTCAGAGGTCCATGGCAGTATCCCAGCCAAATCTCGTGA
TGAATCACCAACACCAGCAGCAGATGGCCCCCAGTACCCTGAGCCAGCAGAACCACCCCA
CTCAGAACCCACCCGCAGGGCTCATGAGTATGCCCAATGCGCTGACCACTCAGCAGCAGC
AGCAGCAGAAACTGCGGCTTCAGAGAATCCAGATGGAGAGAGAAAGGATTCGAATGCGCC
AAGAGGAGCTCATGAGGCAGGAAGCTGCCCTCTGTCGACAGCTCCCCATGGAAGCTGAGA
CTCTTGCCCCAGTTCAGGCTGCTGTCAACCCACCCACGATGACCCCAGACATGAGATCCA
TCACTAATAATAGCTCAGATCCTTTCCTCAATGGAGGGCCATATCATTCGAGGGAGCAGA
GCACTGACAGTGGCCTGGGGTTAGGGTGCTACAGTGTCCCCACAACTCCGGAGGACTTCC
TCAGCAATGTGGATGAGATGGATACAGGAGAAAACGCAGGACAAACACCCATGAACATCA
ATCCCCAACAGACCCGTTTCCCTGATTTCCTTGACTGTCTTCCAGGAACAAACGTTGACT
TAGGAACTTTGGAATCTGAAGACCTGATCCCCCTCTTCAATGATGTAGAGTCTGCTCTGA
ACAAAAGTGAGCCCTTTCTAACCTGGCTGTAATCACTACCATTGTAACTTGGATGTAGCC
ATGACCTTACATTTCCTGGGCCTCTTGGAAAAAGTGATGGAGCAGAGCAAGTCTGCAGGT
GCACCACTTCCCGCCTCCATGACTCGTGCTCCCTCCTTTTTATGTTGCCAGTTTAATCAT
TGCCTGGTTTTGATTGAGAGTAACTTAAGTTAAACATAAATAAATATTCTATTTTCATTT
TCTGCAAGCCTGCGTTCTTGTGACAGATTATACAGAATTGTGTCTGCAGGATTGATTATG
CAGAATACTTTTCTCTTTCTTCTCTGCTGCCCCATGGCTAAGCTTTATGGGTGTTAATTG
AAATTTATACACCAATTGATTTTAAACCATAAAAAGCTGACCACAGGCAGTTACTTCTGA
GGGCATCTTGGTCCAGGAAATGTGCACAAAATTCGACCTGATTTACAGTTTCAAAAACTG
TATTGATGACAGTAGTACCAAATGCTTTAAAAACTATTTAACTTGAGCTTTAAAAATCAT
TGTATGGATAGTAAAATTCTACTGTATGGAATACAATGTAATTTTGAATCCATGCTGGCT
CTGATGGCTCTTATTAGTCTGTATTTATAAAGGCACACAGTCCTATTGTAGCTTATCTTT
CGTTATTTTACTGCAGAGCATCTAGACAACTTAGTCCCTCCAGCGGGAAAGTAGCAGCAG
CAGCATTAGTCACAGGTCTTACACTACAGATCTTGTGAAAGAGACCAGTTTGGTACTAAT
TATGAGCATTTTATTCAAACAAAAGTTTTTGAAATATTACAACTGGGGATTTAAAAAATT
GCAGCTTAGAATCTGATGGTTTTTTTTTTTCTTGATGTTGTTTGTTTGTTTTTGAGATCG
AGTTTTGCTCTTGTTGTCCAGGCTGGAATGCAATGGCACAATCTCGGCTCACTGCAACCT
CTGCCTTCTGGGTTCAAGCGATTCTCCTGCCTTAGCCTCCCGAGTAGCTGGGATTACAGG
CACCTGCCACCACGTCCGGCTAATTTTTTGTATTTTGAGTAGAGACGGGGTTTCACCATA
ATGGTCAGGCTGTTCTCAAACTCCTGATCTCAGGTGATCCACCCATCTCGGCCTCCCAAA
GTGCTGGGATTACTGGCGTGAGCCACCGCACCCGGCCTTGATGTTTATTTTATAAAGCAC
TGTAATTTTGTAGCTGATGACAAAAGGCAGCCAAATGTTTTTGATAAATCAGTGGCAACT
GTATTTTTGTCTTTTGAAATAACTCTGAAAACATCAGGACAACATAGATTTCAACCTGAT
AGCACACCACACACAGTGAGCTGTTGCTTTTTAAATTCTGAAGCCTTGTCAGGTTTGCTT
CCTAGATTTCAAGTGTTTAAAATAATTCTATCTATGAAACTGAAGGATGAAGCAGATCTC
TGACTGACATGTAAAAAAAAATGCCCTTTGAGGGTGTATGGTGGAGATAAATGTTTCTGA
ATTCAGTAAAATTGATTCCTAAGTATATTATCCTAATCCTGTTTGCTACAGTTGGTATAA
AAAGGCATGAAATATGTATTCAATACCTCTTATGTAACCAAAACCATTTTTAATTAGCTT
TTAAGGACTGAGAGAGCATCATGTTCAACTGGCATGCAGTCTGCCTGCATTGCCAATGAA
GTCCTCAACTGTTTAATATTTTGAACTAATATTATTTATAATCTATGAATTTAATCTTTT
TTGAAAGACTTTAATAATTTGAGTCTCTGAGAGGATACTTTCAATTTCCATGGGGGACTT
ATTTGTTGGGGATCTTAAATAAGATTCCTTTTGATCTACCGGAATATACATGTACAGAGT
ACATTGGATCATGTTGGAAAGAAGGCAAGTGAAAAGGTCAGAGATGAAGTAGCAAAGTTA
TGGAATATCGTGGAAAGGATACTAGTTGTGAAATGGAAAGAGACAAGTTATAGTACCCCA
AAAGCAAAACAAGCAGGAGATGCAAGAGATGCCCCAAAAGGACAAAGCAACAATTTTCTG
TTGCCACCTTTATACCGGAAGACTCTGTTGTAGAAGAAAAGAAGGCTTTGGTGCACCTTA
TGTGGGAGGAGGAGGGGCAGGGCATGCTGATGCTGAGCGTACAGGCAGACAAGAGCGTAG
CCTGCTGTTGCCTCCATCACTATGAAATGACTTATTTTACCTGAAGGACCCATGGTTTAT
GTTCCTCTAATTCCTTTCACTCTCCCTAAGCCCTCTGAGAGAGATGAAGATAGATGATTT
TATTGCTACTAAATTGAAGGGAGCACTATTTCTTTTTGTCTTTTGTTAGCAAAAAATTGC
AAAAAGAATTGTACATTCTTGCTAAAAATAAATAAATAAATAAAAAATTAAAAAAACAAG
GGACCTAACAAAACTCAGCAGTGTTACTGTATTTTTAAAAAATATTTTTATAGACTCATT
TTCAGGTTATTAAATGTAAGAGAAACAGATACCCCTCTTTTTTAAAGTAGGTAAATCATT
GATGATTTATATTACCAATTTTTAGAAGTAATTTTCTAGTAAGCTTGTGGCATCAGAAAA
TACTAGAAGATTTTTTTAGTTAAATTAGTTAGAACATTTATGAATGAATATAATAAATAT
TTTTTCAGAATAAAATATGGACCCTTTGTGTTTACTAATAGATAAAGCCAGATATAATTT
TTTGTTTTTAAGGCCACAAAATATGGCCTTTGTTAAAGAACACTAAAGTTAGAAATCTAA
AGTTAGAGCAACTTTTTAATGGCTATTTCCTATTATTGTAAGTGTTAAAACCCCTGCAGA
ATTCTTGATAAGGTGCTATTTATACTATATTTCTTATTATAAGATAACTGTCTTTAGTCT
TCTTAGTACTAGTCTTTTTAGTACTAAATCAATCAGTAAACATCATCATTTCACCCCAAA
ATTTTGTCACAGAAAAGGCGTATCAAATGAAAAATAATTTCAGAGATCTTTCTTTCAAGA
TATTTTTTCCTGATAAAATACATTGTCTTGAAGTAAATACATTGTCAAAACCTAATTGCA
ATTCTGTTAAATCTAAGTAATTTTTAGACAGTGTTTCACCGTATTATTTAGGATGTGAAA
TGCCATTTCTTTCACTGATTACACCATATACAGGAAACAGGTAAAACAGTGAAAACTTTA
TTGTGCTGGTTGATGCCAACTTGGTTGAAAAGCTCTCTGCAGAAGAAGTGATCTAGACTG
ACAGAAGTGTTGCTAATTACAAGTTGTGTTCTCATGACGTAATTAGAAAGTAACTTCTCA
AAGTACAACTTTTATGAAAAAAATAAGCTGTTAAAAAAAGGAAATCGTAGGTTAATTTAA
TTGGGAAAATGGGCAATTGACAGAGACCATTTTCCTAACACATATATGTGCTAGTACTTT
AACTTTTTAAAATTTTACTTCTACGTTTTGTAATATAAAAATTTCTATTTTAAGTTTAGA
ATGTTATACGTACCGAAAGTATGCAGCCAAATCGATCAGATCAAACCATTTTACCTGGAG
TTTGGTACTGGTTTTTACTTCTCTGAATCTGTATAAGAAAAATAAAGACAATTGAACTTC
CA

Protein Sequence

>25937 : length: 400
MNPASAPPPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGS
HSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDV
TDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSSTPVPQR
SMAVSQPNLVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRI
QMERERIRMRQEELMRQEAALCRQLPMEAETLAPVQAAVNPPTMTPDMRSITNNSSDPFL
NGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDF
LDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL