ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

25901

Name

CCDC28A

Synonym

C6orf80|CCRL1AP;coiled-coil domain containing 28A;CCDC28A;coiled-coil domain containing 28A

Definition

chemokine C-C motif receptor-like 1 adjacent|coiled-coil domain-containing protein 28A

Position

6q23.1-q24.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

25901

Links to epithelial mesenchymal transition gene database

25901

Links to ovarian cancer gene database

25901

Links to endometrial cancer gene database

25901

Links to iHOP

25901

Sequence Information

Nucleotide Sequence

>25901 : length: 1661
AAAGGGTACTGCATTTCCCGTTTCTACCTCCACTGCACCCGCTTATTGCGTCTTGCTCCT
GGGTCACAGAGCCTAAAACGACACACCCAACACGCCCGCCGGAGTTACAGCTAAAGGAAG
GACAGGGGAAGCAATGAAATGCCGAGGGCGGAGCCAAGAGCGACACTGGGGGAGCAGGAA
AAGGCGGGGCTTCCGCTTGGGGCATGGAGGCTGTACCTCTTACGTCACTTCCGTAAACAA
ACGGAGCTGCGGAGGAGCGGGTCCCGGGATGTGACCGGGGCTCTGCTTGTGGCTGCGGCG
GTGGCTTCTGAGGCTGTCGGGTCTTTGCGGGTTGCGGAAGGGGGCCCCAATACCCTTCTT
CTTCAGGTCTTAAGAAGCTGGCCGTGGTGCAATAAGGAACTTAAAACAATGGAAGAGCGG
AAAGTGAAGAGGAGGAGTCCTAAGTCTTTTAGTGCCCACTGTACTCAGGTTGTCAATGCC
AAAAAAAATGCCATTCCAGTGAGTAAAAGCACAGGGTTTTCAAATCCTGCATCACAGTCA
ACTTCACAGCGACCAAAGTTAAAAAGAGTGATGAAAGAAAAGACCAAACCTCAGGGTGGA
GAGGGCAAAGGCGCTCAGTCAACTCCGATCCAGCACTCCTTCCTCACTGATGTCTCAGAT
GTTCAGGAGATGGAGAGAGGGCTGCTCAGTCTTTTGAATGATTTCCACTCTGGAAAACTT
CAAGCATTTGGTTAGGCATTTTCCAGGATATGCTTAGGACTGTGTCTTTTCTCATCAATC
TGCCTGGGAATCAGTGAGCCCTTCATATCTGCTGACTCATCTTTCATCTCACGTAACATA
TTTTCTATTGTTTATTATTTTTCTTCCATCTCTTCCTTTTTAGCCTCTGAAGCTTCTATT
GTTCTCATGGTAGGTCACCTAGATCCGTCCTCTGACTCTCATCTTTTCCCATATGATTTC
TACCTCTTTATATTTTTACTGTACATTTACATACATAAACACAAACATACATACATACAC
ACAAACACGTATCTTGAGATATTTCTGTTTCTTCCACTTGACCTTCCAGGTTACTAATGT
TGAAAAACATGACTAAAATAGAGGAAATATGACATATTTTACTGTGAAGAAAGGACGATT
TTGAGAGAGCCATAACTAGCTTCAACATTAGTAGTCCTTAACATAATGTCGTATAGTCCA
TTTATGAAGATGTTATAAAGCTGGCTAGAGGAAACTAGCATAATTTACATTAATTCATAT
TTATTTAGGATATGTACTTCAACTTTAGCTGAGGTATATTTTACCTGTATAGTACCTTTA
GGAAAAACAGAAAGGTTTTTTTTTTAAAAAATTCTACTATCAAGGGATTGCAGAGTCTGT
ACTTAAACTGAATGAAAAGATAATACGTTATGTGTATAAATTAGTTGCTCTGGGCAGATA
ATGTCACTTCAGAGGACTCTTGGTCAATATGTAATGTAAGACCTATTCTTTAGCAATTAA
GTTGTCTTGACAACTGTGTGTACAATTAAAAATATTACATAGTGTTGCTCATGCTTCATG
CCATTTTTCATGCTTCATAAATATTTTTATTTATATTTCTTAAAGGAAGAATACATAATT
GGTTGAAAAAATGATTCACATTTGAAGTCGTTATTGAACTT

Protein Sequence

>25901 : length: 343
MPRAEPRATLGEQEKAGLPLGAWRLYLLRHFRKQTELRRSGSRDVTGALLVAAAVASEAV
GSLRVAEGGPNTLLLQVLRSWPWCNKELKTMEERKVKRRSPKSFSAHCTQVVNAKKNAIP
VSKSTGFSNPASQSTSQRPKLKRVMKEKTKPQGGEGKGAQSTPIQHSFLTDVSDVQEMER
GLLSLLNDFHSGKLQAFGNECSIEQMEHVRGMQEKLARLNLELYGELEELPEDKRKTASD
SNLDRLLSDLEELNSSMYPLSAINSEKFTTYNFWLVFWMPKKHIMFILIIMRLFRLYLLP
RVTLTSLFSLSRYIQADHFHKGFHLYLNLAFCLILLSVDFYMC