ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

25875

Name

LETMD1

Synonym

1110019O13Rik|HCCR-1|HCCR-2|HCCR1|HCRR-2;LETM1 domain containing 1;LETMD1;LETM1 domain containing 1

Definition

LETM1 domain-containing protein 1|cervical cancer 1 proto-oncogene protein p40|cervical cancer proto-oncogene 2 protein|regulator of TP53

Position

12q13.12

Gene Type

protein-coding

External Links

Links to cell senescence gene database

25875

Links to epithelial mesenchymal transition gene database

25875

Links to ovarian cancer gene database

25875

Links to endometrial cancer gene database

25875

Links to iHOP

25875

Sequence Information

Nucleotide Sequence

>25875 : length: 2190
GTACGGTTAACTTTGACCCAAAGACAACCTCTTCTCTCCCGCTTCTCTCGCTGTGAAGAT
GGCGCTCTCCAGGGTGTGCTGGGCTCGGTCGGCTGTGTGGGGCTCGGCAGTCACCCCTGG
ACATTTTGTCACCCGGAGGCTGCAACTTGGTCGCTCTGGCCTGGCTTGGGGGGCCCCTCG
GTCTTCAAAGCTTCACCTTTCTCCAAAGGCAGATGTGAAGAACTTGATGTCTTATGTGGT
AACCAAGACAAAAGCGATTAATGGGAAATACCATCGTTTCTTGGGTCGTCATTTCCCCCG
CTTCTATGTCCTGTACACAATCTTCATGAAAGGATTGCAGATGTTATGGGCTGATGCCAA
AAAGGCTAGAAGAATAAAGACAAATATGTGGAAGCACAATATAAAGTTTCATCAACTTCC
ATACCGGGAGATGGAGCATTTGAGACAGGTATGGGCCAGGGGCAGATATCCAGAAGTTCA
TGGTGAGTTCCGCCAAGACGTCACCAAGTGTCTTTTCCTAGGTATTATTTCCATTCCACC
TTTTGCCAACTACCTGGTCTTCTTGCTAATGTACCTGTTTCCCAGGCAACTACTGATCAG
GCATTTCTGGACCCCAAAACAACAAACTGATTTCTTAGATATCTATCATGCTTTCCGGAA
GCAGTCCCACCCAGAAATTATTAGTTATTTAGAAAAGGTCATCCCTCTCATTTCTGATGC
AGGACTCCGGTGGCGTCTGACAGATCTGTGCACCAAGATACAGCGTGGTACCCACCCAGC
AATACATGATATCTTGGCTCTGAGAGAGTGTTTCTCTAACCATCCTCTGGGCATGAACCA
ACTCCAGGCTTTGCACGTGAAAGCCTTGAGCCGGGCCATGCTTCTCACATCTTACCTGCC
TCCTCCCTTGTTGAGACATCGTTTGAAGACTCATACAACTGTGATTCACCAACTGGACAA
GGCTTTGGCAAAGCTGGGGATTGGCCAGCTGACTGCTCAGGAAGTAAAATCGGCTTGTTA
TCTCCGTGGCCTGAATTCTACGCATATTGGTGAAGATAGGTGTCGAACTTGGCTGGGAGA
ATGGCTGCAGATTTCCTGCAGCCTGAAAGAAGCTGAGCTGTCTCTCTTGCTGCACAACGT
GGTCCTGCTCTCCACCAACTACCTTGGGACAAGGCGCTGAATGAACCATGGAGCGGATGG
CATTGTCCTGCAGTCGTATAGTATAGCAGTGCAGGAACAAACAGCACTTGCCAGCAAAGT
CTGTGTGTACTGTTAAGTGTGTGGGAGGCAGAGAGAGGAGCAGGGGCCATGGGCTTCACA
GCATGGCACACATGTGGGAACTGCAGACATTCCTCTCACAGCTAGAACTGAAACAAACCC
TCTTGCTAGGGGTGGTCCGTGTGAGGTGTCATCCTGTCCCCCTCATAATTACTAATAGCT
GGAACTGGCAGCAGCCTCTACTGGGCTTTTACTGTGATGTGTTCAGTTCATGTCCTAGGA
AGTCAGCTTTTGCCCCAGGTGGGAATCCTTATTTGGCTTAGGACTGATCCACTTCCATGT
TACTTACATCTGTGGGTTTTTGTTGTTGCTGTTAGAAAATTTGTGGCTGGTGAAAACAGC
ACTCCTTTGGCTGGAGCACTTGTGTCCGTGCATGTACTTGGGTGTTTCCCTCCATCCTTT
CTGATATGACCAAAAATCAAGTTGTTTTGTTTTTTGTCACCTTCACTGGCATGGGCTAAC
CACTTCTTTTTCAAACCCTCTGAACACCTTTTTCTGATGGGTAACTTGCAGGAATATTCT
ATTGGAAAAGATAACAGGAAGTACAAGTGCTTCTTGACCCCTTCCTCAATGTTTCTAGCC
TTCACTCTCCATTGTCTTTTCTGGGCTGTATTACAGCCCTCTGTGGATCTTCAACTCTGC
TGCCTCCACTGTGATGCAGCAGTCCAACTGTAACTGACAGTGGCTGCCTTCTCTGGGCCA
TGGATCACACCTGTAAGGTACTAATTACTGCCCAGCCTGGGGAGATCAGGAGAGGTCTGC
ATAGTTAGTAAGTTGGGTTTAGCTTTTGTGTGTGCATCAGTGACTTAGAGTTCTGTAATA
ACTTATTGTAAATGCATGAAGCACTGTTTTTAAACCCAAGTAAAGACTGCTTGAAACCTG
TTGATGGAAATGAAAAAAAAAAAAAAAAAA

Protein Sequence

>25875 : length: 373
MALSRVCWARSAVWGSAVTPGHFVTRRLQLGRSGLAWGAPRSSKLHLSPKADVKNLMSYV
VTKTKAINGKYHRFLGRHFPRFYVLYTIFMKGLQMLWADAKKARRIKTNMWKHNIKFHQL
PYREMEHLRQVWARGRYPEVHGEFRQDVTKCLFLGIISIPPFANYLVFLLMYLFPRQLLI
RHFWTPKQQTDFLDIYHAFRKQSHPEIISYLEKVIPLISDAGLRWRLTDLCTKIQRGTHP
AIHDILALRECFSNHPLGMNQLQALHVKALSRAMLLTSYLPPPLLRHRLKTHTTVIHQLD
KALAKLGIGQLTAQEVKSACYLRGLNSTHIGEDRCRTWLGEWLQISCSLKEAELSLLLHN
VVLLSTNYLGTRR