ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

25849

Name

PARM1

Synonym

Cipar1|DKFZP564O0823|PARM-1|WSC4;prostate androgen-regulated mucin-like protein 1;PARM1;prostate androgen-regulated mucin-like protein 1

Definition

WSC4, cell wall integrity and stress response component 4 homolog|castration-induced prostatic apoptosis-related protein 1|prostatic androgen-regulated mucin-like protein 1|prostatic androgen-repressed message 1|prostatic androgen-repressed message-1

Position

4q13.3-q21.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

25849

Links to epithelial mesenchymal transition gene database

25849

Links to ovarian cancer gene database

25849

Links to endometrial cancer gene database

25849

Links to iHOP

25849

Sequence Information

Nucleotide Sequence

>25849 : length: 5116
AGAAGAGCGCGGAGCACCGGAGGGCACGCAGCTGACGGAGCTGCGCTGCGTTCGCCTCGT
TTGCCTCGCGCCCTCCACTGGAGCTGTTCGCGCCTCCCGGCTCCCACCGCAGCCCACCCG
GCAGAGGAGTCGCTACCAGCGCCCAGTGCGCTCTGTCAGTCCGCAAACTCCTTGCCGCCC
GCCCCGGGCTGGGCACCAAATACCAGGCTACCATGGTCTACAAGACTCTCTTCGCTCTTT
GCATCTTAACTGCAGTTCTAGAGATTGGGAAGTCCAAGATCAGGGCATCTGCAGGTTCTG
CGTCTGGAGGGGGCTGTCTTTCTGGTTCACTAGCTGTGTCTTCCTCATGTGGTGGAAGGG
GATGGAGGGTACAGAGTCTGCCTACATCAGCTCCTTTGTCTGTTTCTCTTCCGACAAACA
TTGTACCACCGACCACCATCTGGACTAGCTCTCCACAAAACACTGATGCAGACACTGCCT
CCCCATCCAACGGCACTCACAACAACTCGGTGCTCCCAGTTACAGCATCAGCCCCAACAT
CTCTGCTTCCTAAGAACATTTCCATAGAGTCCAGAGAAGAGGAGATCACCAGCCCAGGTT
CGAATTGGGAAGGCACAAACACAGACCCCTCACCTTCTGGGTTCTCGTCAACAAGCGGTG
GAGTCCACTTAACAACCACGTTGGAGGAACACAGCTCGGGCACTCCTGAAGCAGGCGTGG
CAGCTACACTGTCGCAGTCCGCTGCTGAGCCTCCCACACTCATCTCCCCTCAAGCTCCAG
CCTCATCACCCTCATCCCTATCAACCTCACCACCTGAGGTCTTTTCTGCCTCCGTTACTA
CCAACCATAGCTCCACTGTGACCAGCACCCAACCCACTGGAGCTCCAACTGCACCAGAGT
CCCCGACAGAGGAGTCCAGCTCTGACCACACACCCACTTCACATGCCACAGCTGAGCCAG
TACCCCAGGAGAAAACACCCCCAACAACTGTGTCAGGCAAAGTGATGTGTGAGCTCATAG
ACATGGAGACCACCACCACCTTTCCCAGGGTGATCATGCAGGAAGTAGAACATGCATTAA
GTTCAGGCAGCATCGCCGCCATTACCGTGACAGTCATTGCCGTGGTGCTGCTGGTGTTTG
GAGTTGCAGCCTACCTAAAAATCAGGCATTCCTCCTATGGAAGACTTTTGGACGACCATG
ACTACGGGTCCTGGGGAAACTACAACAACCCTCTGTACGATGACTCCTAACAATGGAATA
TGGCCTGGGATGAGGATTAACTGTTCTTTATTTATAAGTGCTTATCCAGTAGAATTAATA
AGTACCTGATGCGCATTGAACGACAATCTTAAGCCCTGTTTTGTTGGTATGGTTGTTTTT
GTTTTCCTCCCTCTCCTCTGGCTGCTACAACTTCCCCTTTCTGGTACAAGAAGAACCATT
CTTTAAAGGTGAGTGGAGGCTGATTTGCAGCTGAAGTGGGCCAGCCTTGCACCAGCCAGG
CCAGACCACCATGGTGAAGGCTTCTTTCCCCACTGCAGGACCCACTTTGAGAAGGACCGA
GGAGGAGGATTTGGGTTGTTTTGTTAGGGGTTACTTTCAGGGGAACATTTCATTTGTGTT
ATTTCTTAAACTTCTATTTAGGAAATTACATTAAGTATTAATGAGGGGAAAGGAAATGAG
CTCTACGAGGATTTCACCCTGCATGGGAGAGAGCAGGGTTTTCTCAGATTCCTTTTTAAT
CTCTATTTATCTGGTTGTTTCTGACAGGATGCTGCCTGCTTGGCTCTACAAGCTGGAAAG
CAGCTTCTTAGCTGCCTAATTAATGAAAGATGAAAATAGGAAGTGCCCTGGAGGGGGCCA
GCAGGTCACGGGGCAGAATCTCTCAGGTTGCTGTGGGATCTCAGTGTGCCCCTACCTGTT
CTCCCCTCCAGGCCACCTGTCTCTGTAAAGGATGTCTGCTCTGTTCAAAAGGCAGCTGGG
ATCCCAGCCCACAAGTGATCAGCAGAGTTGCATTTCCAAAGAAAAAGGCTATGAGATGAG
CTGAGTTATAGAGAGAAAGGGAGAGGCATGTACGGTGTGGGGAAGTGGAAGAGAAGCTGG
CGGGGGAGAAGGAGGCTAACCTGCACTGAGTACTTCATTAGGACAAGTGAGAATCAGCTA
TTGATAATGGCCAGAGATATCCACAGCTTGGAGGAGCCCAGAGACCGTTTGCTTTATACC
CACACAGCAACTGGTCCACTGCTTTACTGTCTGTTGGATAATGGCTGTAAAATGTTTAAA
AACAAAACAAAACAAAAAAGAGGCACTAGTCTATCTGCAATTACTCAACGAGGCATTTTC
ATAGGAAACAGACTATGATTAATCCATTTATTCTTCCCACACACTTACCTTACTAAGTCT
TTGCTTTAATAAATGAGCAACCCTGGGTATAGTCTTAAAATTCTGCACAATAAATTTTGA
GAAAGAATTGTTCCTCTTTGTAGGTATCTGTGTATTGCAATCATTCTCAACCAGGAGGTG
ATTTTGCCCCCTGACTCCACCCCAGGGACATTCAAAAATGTCTGGTGACAGTTTTCATTG
TCATGACTTGGGGGTGCTACTAGAAGCCAGGAATGCTGCCAAACATTCTACCATGCACAG
CACAACCTACAACAGCAAAGAATCATCCACCCCAAAATATCAGTAGTGCCGAGATTGAGA
AACCCTGATTTATCACAATGCCCACTGTGACAGAACAAGACACTCACAGATTAGTGATAC
GTTTTATTTTTAACAAAATGAAATGATGTGTTAAGTTTTTATTTCCAAAGTGTTTAGTTT
ATTGGCTGATGGGTTGTTCTTGGTATGCATGGTGACCTTTTTATTTCTGTGTGCTTCCTA
GAGAGCTTTATTTCATGGCGACAACTCTGTCTTCTTGTAACAGCTGATATTAGCAAGCAG
CATCTTATGTCCTGATTTCATATAGTAGAAAACAAACATTGGGTCCGACTTCAAAATGTG
TTGTATTGTCCTACAGTGTCATAAAGAACCTGAAAATGAACTTTTGTTTCTAAAGTTGGA
CCTTGCTGCCATGACTGTTTAGTTTACAGAAACTTGACCCCGGCTCATCCTGTCTCTGGC
TGTGGCCCGGCAAAGCACTGAAAACCCCTCTGGTCTCAGAGACAGTAGGGGCAGTGCCAC
TTTCTACAACCTGCCAACCCACACACTGGAGTAATTCTGAAAAAAATTATTCCTAAACTC
TCTAAGTGTGGACGGAGAATGAGCAAGCCCCAGAAGTATTTTACAACCAGAGTGGGTAAT
GAGGAGGGGGCTTACTGGAATCGTCATATCTCTGAATATTGAAAACAACAACTAAAAAAG
TGGACCTTCTCAGAAAAAAAGGGCAGCAAATGACCAAGGGCGCCCCTTCTGGCCGTGCTT
GGCTTGAGTAACTGTCTCTCTTTCCCCACCCCCATCACAGGGCTTTCAGTTTGGCAAAGG
AAAAGCAGATAAAAACAGAACATTCCATATGTTTCTTTCTCCATCGGCCAAAAACATTTT
GACACAATGTTTGTGAAACACCTTTGGAGAGGTGCACTTCTGAATGCTGCCTCTGCCGTA
AATCCTGGGGCAAGGGATCAGCCTCTTCCCAGGAACCATCGCCTTCTATAAACCGTGAAC
TCAAGCAGGCATTTTTTTTTTCTTACCGAAAGGCTGCTATTGTGCAAGGGCACATAATGG
GTCTGTTGCTCTTATTGGCTTCCAAATGTGCATGGCAAAGAGAGAGATGTGGGCCTAGAG
CAGATATATTCAGCAAGGTGACAGCTTCCCATAACAATTCTAACACTTCTTATCTTATGT
GAGAATAAAATATTTAAGGGTTGAACCTTATTTTGCCAAATGTATCTTTTCTGCTTTTGA
ATTGGGCAGAAGATTTTAGCAACTATATTCTACAAATGTTACTTATAACACACACACACA
CATCTGAAATATATGCCGAAAATTGACGTCTTTGACCTCAGGGAGAGCACCTGTCCAGGT
CTGCCTAAAGGAAATGGCTCCAGTGGGTCTAAACAACCACATCCTATCCATGGATAGGTC
TAGTCATAACACTTTAGAGAGAATGTCAGAGCAGGAGGGAGGCAAGCCGCCTCTTCTCGG
CCATCGACTGCAGATGATGAAAGAGCGGGATTCAACTTTGTTTTCTTTTCCTGTGGCCCC
AGTGAAACCTCCTGCCCTCCCTGCACGTCTGTGTCTTCATTTCTAAAATGGGGGTGATGC
TTTCATATTGACCTCACCCCATACTACCTCACAGATGTGTTGTGAGGATTAATAAAATTA
TGTCTATGGTATTTTCAGTTTCTGGAGAAAAATACTTATAGACAGTTTAACTATTACATA
GATATATAAGTGATCTCAGTTTCTTGTTTGCTGTGATACTAATGTGTTGTTTTAACTTAT
TCCATAAAATGACAGTTGTGTCCTAGCCACATCAGACAGCTATCTAAGCTCTGGACTACC
CCTTTGTGCAGCTGAATCACTGCAGGGTTGACCATGCCTGGTGCCACAGCCATGGTTTCC
ATTTCTAGATGAAAGGATGGCCTAGGACATAGGTCTCAAAGACTCTTGGATCAGAATCAG
GAGATTAGGGAAAACAGGATGGATACCTGAGCACTAACAGCAGTAGACGTAGACCTCTGT
CCTTTACCATCTGAGGTCTTCTGGATTCTTTGTGGGGTTAATTTTGATTTGATGTCATCT
GTTTGCCCTTCATCTTGCTTGCAAGTGTGCATGGTTCAATCCCTCACATCCAGGAAATGA
ATTTTGCAATTGGGCCAGATGCTAATTTGCACGTTGATTCACCTTCTTTGCCTTTAAGCC
TTTTTTTTCTTTTTTTTTTTTTTGGCAAATGAATGTACCATTTCAACTTTGATTTTAATA
GTGCTAGTTGATATTGGTAATAATGCTAACCAAGAGATCAATGCCAGATTTTTCTCTTGG
GGTAAGTTAGCTGAAGTCATTTAAAGATGGAAAGGTGGGAAAATTCTTTGATATTTGATG
TCATTGTATCCACATTTGTTGTAAGACATATTGCATACCAATTATAATTATATCAATTAA
AGTTGATAAAAGCTTC

Protein Sequence

>25849 : length: 345
MVYKTLFALCILTAVLEIGKSKIRASAGSASGGGCLSGSLAVSSSCGGRGWRVQSLPTSA
PLSVSLPTNIVPPTTIWTSSPQNTDADTASPSNGTHNNSVLPVTASAPTSLLPKNISIES
REEEITSPGSNWEGTNTDPSPSGFSSTSGGVHLTTTLEEHSSGTPEAGVAATLSQSAAEP
PTLISPQAPASSPSSLSTSPPEVFSASVTTNHSSTVTSTQPTGAPTAPESPTEESSSDHT
PTSHATAEPVPQEKTPPTTVSGKVMCELIDMETTTTFPRVIMQEVEHALSSGSIAAITVT
VIAVVLLVFGVAAYLKIRHSSYGRLLDDHDYGSWGNYNNPLYDDS