ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

256646

Name

NUTM1

Synonym

C15orf55|FAM22H|NUT;NUT midline carcinoma, family member 1;NUTM1;NUT midline carcinoma, family member 1

Definition

NUT family member 1|nuclear protein in testis

Position

15q14

Gene Type

protein-coding

External Links

Links to cell senescence gene database

256646

Links to epithelial mesenchymal transition gene database

256646

Links to ovarian cancer gene database

256646

Links to endometrial cancer gene database

256646

Links to iHOP

256646

Sequence Information

Nucleotide Sequence

>256646 : length: 4196
CTACTGTGTGCTAGGTACACGGCGTTAGAGGGGGGTAGGGATGGATGTGGATAGAATATT
GACGTATAGAAGCCTGTCTTTGTCTCAAGATACACACCCATTTCAGGAGCAGTGAGTTTT
CAATGCCTGAAGAAACAAGGGCTCCAGGATTCAGAGCCCCTTTACCCTAGGGAAGAAAGA
AGAGGTTTTCTTCCCTCCCCTCTTTTACATCCAGTTCCCCTGCTCCATTTCAAAGCGTTG
GCGGTAAAGAATGCATGTTGAGTATCAATATTCCGTAAAGCGAAAGAGCGTAAAGTTATT
TTATGAAACTGGTGAAGCATGTTTCAGCGGTCGAACCAAGATTTAAAGTTAGGTCCCTAC
CGCAAATTCAGCGCTCTTTCTTATGGTGAATGCCTTGAGTTCCGTATTCTAGTTCTGTGT
GATCTGATCTTTACCTTCCCTTCCTTGGATCCCTGTGCACCTACTGGAGCCAGGTTACTC
TGGGTCCTGGACCTGACTGCCTCATTCTGGAGGCTTCCAGACAGCCACAGTTAGTGCCCA
AACCTGAGAGGATGGCTTCAGATGGAGCATCTGCATTGCCGGGACCGGATATGAGCATGA
AACCTAGTGCCGCCCTGTCTCCATCCCCTGCACTTCCCTTTCTCCCACCAACTTCTGACC
CACCAGACCACCCACCCAGGGAGCCACCTCCACAGCCCATCATGCCTTCAGTATTCTCTC
CAGACAACCCTCTGATGCTCTCTGCTTTCCCCAGCTCACTGTTGGTGACAGGGGACGGGG
GCCCTTGCCTCAGTGGGGCTGGGGCTGGCAAGGTCATTGTCAAAGTCAAGACAGAAGGGG
GGTCAGCTGAGCCCTCTCAAACTCAGAACTTTATCCTTACTCAGACTGCCCTCAATTCGA
CTGCCCCGGGCACTCCCTGTGGAGGCCTTGAGGGTCCTGCACCTCCATTTGTGACAGCAT
CTAATGTGAAGACCATTCTGCCCTCTAAGGCTGTTGGTGTCAGCCAGGAGGGTCCTCCAG
GCCTTCCGCCTCAGCCTCCACCACCAGTTGCTCAACTGGTCCCCATTGTGCCCCTGGAAA
AAGCTTGGCCAGGGCCACATGGGACAACCGGGGAAGGAGGTCCTGTGGCCACTCTATCCA
AGCCTTCCCTAGGTGACCGCTCCAAAATTTCCAAGGACGTTTATGAGAACTTCCGTCAGT
GGCAGCGTTACAAAGCCTTGGCCCGGAGGCACCTATCCCAGAGTCCTGACACAGAAGCTC
TTTCCTGTTTTCTTATCCCAGTGCTTCGTTCCCTGGCCCGGCTGAAGCCCACTATGACCC
TGGAGGAGGGACTGCCATTGGCTGTGCAGGAGTGGGAGCACACCAGCAACTTTGACCGGA
TGATCTTTTATGAGATGGCAGAAAGGTTCATGGAGTTTGAGGCTGAGGAGATGCAGATTC
AGAACACACAGCTGATGAATGGGTCTCAGGGCCTGTCTCCTGCAACCCCTTTGAAACTTG
ATCCTCTAGGGCCCCTGGCCTCTGAGGTTTGCCAGCAGCCAGTGTACATTCCGAAGAAGG
CAGCCTCCAAGACACGGGCCCCCCGCCGGCGTCAGCGTAAAGCCCAGAGACCTCCTGCTC
CTGAGGCACCCAAGGAGATCCCACCAGAAGCTGTGAAGGAGTATGTTGACATCATGGAAT
GGCTGGTGGGGACTCACTTGGCCACTGGGGAGTCAGATGGAAAACAAGAGGAAGAAGGGC
AGCAGCAGGAGGAGGAAGGGATGTATCCAGATCCAGGTCTCCTGAGCTACATCAATGAGC
TGTGTTCTCAGAAGGTCTTTGTCTCCAAGGTGGAGGCTGTCATTCACCCTCAATTTCTGG
CAGATCTGCTGTCCCCAGAAAAACAGAGAGATCCCTTGGCCTTAATTGAGGAGCTAGAGC
AAGAAGAAGGACTCACTCTTGCCCAGCTGGTCCAGAAGCGACTCATGGCCTTGGAAGAGG
AGGAAGATGCAGAGGCGCCTCCAAGTTTCAGTGGCGCTCAGTTGGACTCAAGTCCTTCTG
GTTCTGTTGAGGATGAAGATGGGGATGGGCGGCTTCGGCCCTCACCTGGGCTTCAGGGGG
CTGGGGGCGCCGCTTGCCTTGGAAAGGTTTCTTCTTCAGGAAAACGGGCAAGAGAAGTGC
ATGGTGGGCAGGAGCAAGCCCTAGATAGCCCCAGAGGGATGCACAGGGATGGGAACACTC
TGCCATCCCCCAGCAGCTGGGACCTGCAGCCAGAACTTGCAGCTCCACAGGGAACTCCGG
GACCCTTGGGTGTGGAGAGGAGAGGGTCTGGGAAGGTTATAAACCAGGTATCTCTACATC
AGGATGGCCATCTAGGAGGCGCTGGGCCTCCTGGGCACTGCCTGGTGGCTGATAGGACTT
CAGAGGCTCTGCCCCTTTGTTGGCAGGGAGGCTTCCAGCCTGAGAGCACTCCCAGTTTGG
ATGCTGGACTTGCAGAGCTGGCTCCTCTGCAAGGACAAGGGTTAGAAAAGCAAGTCCTGG
GATTGCAGAAAGGACAACAAACAGGGGGTCGTGGAGTGCTTCCTCAAGGGAAGGAGCCTT
TAGCAGTGCCCTGGGAAGGCTCTTCAGGAGCCATGTGGGGAGATGACAGAGGTACCCCCA
TGGCTCAGAGTTATGATCAGAATCCTTCCCCTAGAGCAGCTGGGGAGAGGGACGATGTCT
GTCTCAGCCCAGGAGTTTGGCTGAGCAGTGAGATGGATGCTGTAGGCTTGGAGCTGCCTG
TACAAATAGAGGAGGTCATAGAGAGCTTCCAAGTTGAGAAGTGTGTAACTGAGTATCAGG
AAGGCTGCCAGGGACTGGGCTCCAGGGGCAACATTTCCCTGGGTCCTGGAGAAACCCTAG
TACCTGGGGATACGGAGAGCAGTGTGATTCCCTGTGGAGGCACAGTTGCGGCAGCTGCCC
TAGAAAAGAGAAACTATTGCAGCTTGCCAGGACCTTTGAGGGCCAACAGCCCACCCTTGA
GGTCCAAAGAAAATCAAGAACAGAGCTGTGAAACCGTAGGGCATCCCAGTGATCTGTGGG
CAGAAGGTTGCTTCCCATTGCTAGAAAGTGGTGATTCCACACTGGGGTCTTCCAAAGAAA
CCCTTCCACCCACATGCCAAGGCAATCTCCTTATCATGGGGACTGAGGATGCCTCCTCCT
TGCCTGAAGCCAGTCAAGAGGCAGGGAGCAGAGGCAATTCCTTTTCTCCTCTGTTGGAAA
CCATAGAACCTGTCAACATACTAGATGTTAAAGATGACTGTGGCCTCCAACTAAGGGTCA
GCGAGGACACCTGCCCACTGAATGTTCATTCTTATGACCCCCAAGGAGAAGGCAGGGTGG
ATCCTGATCTGTCCAAGCCTAAAAACCTTGCTCCTTTACAAGAGAGTCAGGAGTCTTACA
CAACTGGGACTCCCAAAGCAACATCTTCTCACCAGGGCCTTGGAAGCACTTTGCCTAGAA
GGGGAACCAGGAATGCCATAGTTCCGAGAGAAACTTCTGTTAGTAAAACACACAGGTCAG
CAGACAGGGCCAAAGGAAAGGAGAAAAAGAAAAAGGAAGCAGAGGAAGAGGATGAGGAAC
TCTCCAACTTTGCTTACCTCTTGGCCTCTAAACTTAGCCTCTCACCAAGGGAGCATCCCC
TCAGTCCTCACCATGCCTCAGGAGGTCAGGGCAGCCAGAGAGCATCCCACCTGCTCCCTG
CTGGAGCAAAAGGCCCCAGCAAACTTCCATATCCTGTTGCCAAGTCTGGGAAGCGAGCTC
TAGCTGGAGGTCCAGCCCCTACTGAAAAGACACCCCACTCAGGAGCTCAACTTGGGGTCC
CCAGGGAGAAACCCCTAGCTCTGGGAGTAGTTCGACCCTCACAGCCTCGTAAAAGGCGGT
GTGACAGTTTTGTCACGGGCAGAAGGAAGAAACGACGTCGTAGCCAGTAGGGAGCAGCGG
GACCATCTGACCCCACTTGCCAGTCCCTAAAGGTGGGTGCCCCAGAGTAGATTCCACCCC
TGCTGCCCACCAATGGAGAATCCCAATGTTGAATCTCATCCCAATGTTGTTTTGTTGTTC
TGCAAAAGTGGCAAGCATGGAGAGAGAGGTCAGACTGGCTAGGCTGCAGGGGGAATTACC
TTTGGAAGGAGCTATATAGAAAAAAAATGAATAAAGTGTTTTGTTGGAAAATGCTC

Protein Sequence

>256646 : length: 1160
MVVTLGPGPDCLILEASRQPQLVPKPERMASDGASALPGPDMSMKPSAALSPSPALPFLP
PTSDPPDHPPREPPPQPIMPSVFSPDNPLMLSAFPSSLLVTGDGGPCLSGAGAGKVIVKV
KTEGGSAEPSQTQNFILTQTALNSTAPGTPCGGLEGPAPPFVTASNVKTILPSKAVGVSQ
EGPPGLPPQPPPPVAQLVPIVPLEKAWPGPHGTTGEGGPVATLSKPSLGDRSKISKDVYE
NFRQWQRYKALARRHLSQSPDTEALSCFLIPVLRSLARLKPTMTLEEGLPLAVQEWEHTS
NFDRMIFYEMAERFMEFEAEEMQIQNTQLMNGSQGLSPATPLKLDPLGPLASEVCQQPVY
IPKKAASKTRAPRRRQRKAQRPPAPEAPKEIPPEAVKEYVDIMEWLVGTHLATGESDGKQ
EEEGQQQEEEGMYPDPGLLSYINELCSQKVFVSKVEAVIHPQFLADLLSPEKQRDPLALI
EELEQEEGLTLAQLVQKRLMALEEEEDAEAPPSFSGAQLDSSPSGSVEDEDGDGRLRPSP
GLQGAGGAACLGKVSSSGKRAREVHGGQEQALDSPRGMHRDGNTLPSPSSWDLQPELAAP
QGTPGPLGVERRGSGKVINQVSLHQDGHLGGAGPPGHCLVADRTSEALPLCWQGGFQPES
TPSLDAGLAELAPLQGQGLEKQVLGLQKGQQTGGRGVLPQGKEPLAVPWEGSSGAMWGDD
RGTPMAQSYDQNPSPRAAGERDDVCLSPGVWLSSEMDAVGLELPVQIEEVIESFQVEKCV
TEYQEGCQGLGSRGNISLGPGETLVPGDTESSVIPCGGTVAAAALEKRNYCSLPGPLRAN
SPPLRSKENQEQSCETVGHPSDLWAEGCFPLLESGDSTLGSSKETLPPTCQGNLLIMGTE
DASSLPEASQEAGSRGNSFSPLLETIEPVNILDVKDDCGLQLRVSEDTCPLNVHSYDPQG
EGRVDPDLSKPKNLAPLQESQESYTTGTPKATSSHQGLGSTLPRRGTRNAIVPRETSVSK
THRSADRAKGKEKKKKEAEEEDEELSNFAYLLASKLSLSPREHPLSPHHASGGQGSQRAS
HLLPAGAKGPSKLPYPVAKSGKRALAGGPAPTEKTPHSGAQLGVPREKPLALGVVRPSQP
RKRRCDSFVTGRRKKRRRSQ