ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2534

Name

FYN

Synonym

SLK|SYN|p59-FYN;FYN proto-oncogene, Src family tyrosine kinase;FYN;FYN proto-oncogene, Src family tyrosine kinase

Definition

FYN oncogene related to SRC, FGR, YES|OKT3-induced calcium influx regulator|c-syn protooncogene|proto-oncogene Syn|proto-oncogene c-Fyn|src-like kinase|src/yes-related novel|tyrosine kinase p59fyn(T)|tyrosine-protein kinase Fyn

Position

6q21

Gene Type

protein-coding

Pathways and Diseases

Pathway

Collagen adhesion via GPVI;PID Reactome;500288

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Hemostasis;Reactome;REACT:604

Pathway

Nephrin/Neph1 signaling in the kidney podocyte;PID Curated;200132

Pathway

Regulation of p38-alpha and p38-beta;PID Curated;200054

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

Ephrin B reverse signaling;PID Curated;200173

Pathway

HIV Infection;Reactome;REACT:6185

Pathway

Fc-epsilon receptor I signaling in mast cells;PID Curated;200003

Pathway

Alpha-synuclein signaling;PID Curated;200187

Pathway

CXCR4-mediated signaling events;PID Curated;200083

Pathway

role of mef2d in t-cell apoptosis;PID BioCarta;100109

Pathway

PDGFR-beta signaling pathway;PID Curated;200127

Pathway

bioactive peptide induced signaling pathway;PID BioCarta;100226

Pathway

E-cadherin signaling in keratinocytes;PID Curated;200125

Pathway

Class I PI3K signaling events;PID Curated;200098

Pathway

Nef and signal transduction;PID Reactome;500755

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

TCR signaling in naive CD4+ T cells;PID Curated;200022

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

Syndecan-3-mediated signaling events;PID Curated;200170

Pathway

Axon guidance;KEGG PATHWAY;hsa04360

Pathway

Reelin signaling pathway;PID Curated;200051

Pathway

IL2-mediated signaling events;PID Curated;200082

Pathway

CD28 dependent Vav1 pathway;PID Reactome;500486

Pathway

Glypican 1 network;PID Curated;200021

Pathway

Interactions of the immunoglobulin superfamily (IgSF) member proteins;Reactome;REACT:23853

Pathway

Pathogenic Escherichia coli infection;KEGG PATHWAY;hsa05130

Pathway

Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161

Pathway

tsp-1 induced apoptosis in microvascular endothelial cell;PID BioCarta;100010

Pathway

Parkinson disease;PANTHER;P00049

Pathway

Axon guidance mediated by semaphorins;PANTHER;P00007

Pathway

Cell surface interactions at the vascular wall;PID Reactome;500305

Pathway

Cadherin signaling pathway;PANTHER;P00012

Pathway

Thromboxane A2 receptor signaling;PID Curated;200069

Pathway

SEMA3A-Plexin repulsion signaling by inhibiting Integrin adhesion;PID Reactome;500075

Pathway

Integrin signalling pathway;PANTHER;P00034

Pathway

t cell receptor signaling pathway;PID BioCarta;100022

Pathway

EPHA forward signaling;PID Curated;200121

Pathway

Signaling events mediated by PTP1B;PID Curated;200033

Pathway

Fc epsilon RI signaling pathway;KEGG PATHWAY;hsa04664

Pathway

NCAM signaling for neurite out-growth;PID Reactome;500079

Pathway

Prion diseases;KEGG PATHWAY;hsa05020

Pathway

Viral myocarditis;KEGG PATHWAY;hsa05416

Pathway

Angiopoietin receptor Tie2-mediated signaling;PID Curated;200066

Pathway

Ephrin A reverse signaling;PID Curated;200048

Pathway

Signaling events mediated by focal adhesion kinase;PID Curated;200192

Pathway

integrin signaling pathway;PID BioCarta;100123

Pathway

il-7 signal transduction;PID BioCarta;100125

Pathway

lck and fyn tyrosine kinases in initiation of tcr activation;PID BioCarta;100023

Pathway

TCR signaling in naive CD8+ T cells;PID Curated;200062

Pathway

ErbB4 signaling events;PID Curated;200009

Pathway

amb2 Integrin signaling;PID Curated;200108

Pathway

Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650

Pathway

Netrin-mediated signaling;PID Curated;200074

Disease

CHEMDEPENDENCY;GAD

Disease

Alzheimer's disease;GAD

Disease

CARDIOVASCULAR;GAD

Disease

blood pressure, arterial hypertension;GAD

Disease

alcoholism;GAD

Disease

NEUROLOGICAL;GAD

External Links

Links to cell senescence gene database

2534

Links to epithelial mesenchymal transition gene database

2534

Links to ovarian cancer gene database

2534

Links to endometrial cancer gene database

2534

Links to iHOP

2534

Sequence Information

Nucleotide Sequence

>2534 : length: 3767
AGTAGCAGCGAGCAGCCGCGCTGGTGGCGGCGGCGCGTCGTTGCAGTTGCGCCATCTGTC
AGGAGCGGAGCCGGCGAGGAGGGGGCTGCCGCGGGCGAGGAGGAGGGGTCGCCGCGAGCC
GAAGGCCTTCGAGACCCGCCCGCCGCCCGGCGGCGAGAGTAGAGGCGAGGTTGTTGTGCG
AGCGGCGCGTCCTCTCCCGCCCGGGCGCGCCGCGCTTCTCCCAGCGCACCGAGGACCGCC
CGGGCGCACACAAAGCCGCCGCCCGCGCCGCACCGCCCGGCGGCCGCCGCCCGCGCCAGG
GAGGGATTCGGCCGCCGGGCCGGGGACACCCCGGCGCCGCCCCCTCGGTGCTCTCGGAAG
GCCCACCGGCTCCCGGGCCCGCCGGGGACCCCCCGGAGCCGCCTCGGCCGCGCCGGAGGA
GGGCGGGGAGAGGACCATGTGAGTGGGCTCCGGAGCCTCAGCGCCGCGCAGTTTTTTTGA
AGAAGCAGGATGCTGATCTAAACGTGGAAAAAGACCAGTCCTGCCTCTGTTGTAGAAGAC
ATGTGGTGTATATAAAGTTTGTGATCGTTGGCGGACATTTTGGAATTTAGATAATGGGCT
GTGTGCAATGTAAGGATAAAGAAGCAACAAAACTGACGGAGGAGAGGGACGGCAGCCTGA
ACCAGAGCTCTGGGTACCGCTATGGCACAGACCCCACCCCTCAGCACTACCCCAGCTTCG
GTGTGACCTCCATCCCCAACTACAACAACTTCCACGCAGCCGGGGGCCAAGGACTCACCG
TCTTTGGAGGTGTGAACTCTTCGTCTCATACGGGGACCTTGCGTACGAGAGGAGGAACAG
GAGTGACACTCTTTGTGGCCCTTTATGACTATGAAGCACGGACAGAAGATGACCTGAGTT
TTCACAAAGGAGAAAAATTTCAAATATTGAACAGCTCGGAAGGAGATTGGTGGGAAGCCC
GCTCCTTGACAACTGGAGAGACAGGTTACATTCCCAGCAATTATGTGGCTCCAGTTGACT
CTATCCAGGCAGAAGAGTGGTACTTTGGAAAACTTGGCCGAAAAGATGCTGAGCGACAGC
TATTGTCCTTTGGAAACCCAAGAGGTACCTTTCTTATCCGCGAGAGTGAAACCACCAAAG
GTGCCTATTCACTTTCTATCCGTGATTGGGATGATATGAAAGGAGACCATGTCAAACATT
ATAAAATTCGCAAACTTGACAATGGTGGATACTACATTACCACCCGGGCCCAGTTTGAAA
CACTTCAGCAGCTTGTACAACATTACTCAGAGAGAGCTGCAGGTCTCTGCTGCCGCCTAG
TAGTTCCCTGTCACAAAGGGATGCCAAGGCTTACCGATCTGTCTGTCAAAACCAAAGATG
TCTGGGAAATCCCTCGAGAATCCCTGCAGTTGATCAAGAGACTGGGAAATGGGCAGTTTG
GGGAAGTATGGATGGAGAAAGCTGATGGTTTGTGTTTTAACTTAACTGTGATTGCATCGA
GTTGTACCCCACAAACTTCTGGATTGGCTAAAGATGCTTGGGAAGTTGCACGTCGTTCGT
TGTGTCTGGAGAAGAAGCTGGGTCAGGGGTGTTTCGCTGAAGTGTGGCTTGGTACCTGGA
ATGGAAACACAAAAGTAGCCATAAAGACTCTTAAACCAGGCACAATGTCCCCCGAATCAT
TCCTTGAGGAAGCGCAGATCATGAAGAAGCTGAAGCACGACAAGCTGGTCCAGCTCTATG
CAGTGGTGTCTGAGGAGCCCATCTACATCGTCACCGAGTATATGAACAAAGGAAGTTTAC
TGGATTTCTTAAAAGATGGAGAAGGAAGAGCTCTGAAATTACCAAATCTTGTGGACATGG
CAGCACAGGTGGCTGCAGGAATGGCTTACATCGAGCGCATGAATTATATCCATAGAGATC
TGCGATCAGCAAACATTCTAGTGGGGAATGGACTCATATGCAAGATTGCTGACTTCGGAT
TGGCCCGATTGATAGAAGACAATGAGTACACAGCAAGACAAGGTGCAAAGTTCCCCATCA
AGTGGACGGCCCCCGAGGCAGCCCTGTACGGGAGGTTCACAATCAAGTCTGACGTGTGGT
CTTTTGGAATCTTACTCACAGAGCTGGTCACCAAAGGAAGAGTGCCATACCCAGGCATGA
ACAACCGGGAGGTGCTGGAGCAGGTGGAGCGAGGCTACAGGATGCCCTGCCCGCAGGACT
GCCCCATCTCTCTGCATGAGCTCATGATCCACTGCTGGAAAAAGGACCCTGAAGAACGCC
CCACTTTTGAGTACTTGCAGAGCTTCCTGGAAGACTACTTTACCGCGACAGAGCCCCAGT
ACCAACCTGGTGAAAACCTGTAAGGCCCGGGTCTGCGGAGAGAGGCCTTGTCCCAGAGGC
TGCCCCACCCCTCCCCATTAGCTTTCAATTCCGTAGCCAGCTGCTCCCCAGCAGCGGAAC
CGCCCAGGATCAGATTGCATGTGACTCTGAAGCTGACGAACTTCCATGGCCCTCATTAAT
GACACTTGTCCCCAAATCCGAACCTCCTCTGTGAAGCATTCGAGACAGAACCTTGTTATT
TCTCAGACTTTGGAAAATGCATTGTATCGATGTTATGTAAAAGGCCAAACCTCTGTTCAG
TGTAAATAGTTACTCCAGTGCCAACAATCCTAGTGCTTTCCTTTTTTAAAAATGCAAATC
CTATGTGATTTTAACTCTGTCTTCACCTGATTCAACTAAAAAAAAAAAAGTATTATTTTC
CAAAAGTGGCCTCTTTGTCTAAAACAATAAAATTTTTTTTCATGTTTTAACAAAAACCAA
TCAGGACAGGTGTTTGTTTTTGTTTTCTTTTTTATAAATATGAATATATATAATATATAT
GTCCCTGTACATATACAATGTGGGTGCTAATGTGGAGACTGTGGCCGGCCTGAGCCACCA
AGCTGCGGGACCCAGAGGGAGGATTTTACTGCAAGTCAGCATCAAAGCACCGGTGTTATT
CTGAAAACACCAGTGGCCTCATTTTTGGCTTTTGCAAAGCATGAATTTTTTCATTTGGAT
TGCACTTTCCTGGTTCATGACTGTACCTGTAGGTGGTTGTTACTTTGACTCTTTTCAGGA
ACCACCCCCCAAGCTGAATTTACAAGTTCTGTTAGCACTATTTGCTTCAACTTACTGCGA
TTTGTTCTCAAAACTTAAAAATAAGCAAGCAAATGGCTGATACTACCAAGAGAACTGGAA
GATGGATACCACACAAACTTCTTGTATAAAAATATGAATGCTGAAATGTTTCAGACATTT
TTAATTTAATAAACCTGTAACCACATTTAAGTGATCTAAAACCCATAGCATTGTAGTCAT
GGCAACCCGCTAAACTTTCTCATGCAACTAAAATTTCTGGGGGAAATGAGGGTGGGGGTT
GTACATTTCCCATTGTAAAATAAGTGTTTTAAATGTCCTGTACTGCTAACGAATGACTTT
CTATATGTCCAGGAGTTCTCCAGTGGAATAACTATGCACTACTTTACATTTCATGGGGAT
GCACAAAAACAAAAAAGTATTACATTTTTAGTTGCTGTTTGTACCAACCTTAAATTACAT
ATGTTTAACAACAACAAATCAAAAATCCTATTTCTATTGAGTTTTTAATACTGACTAGCA
ACTCTGAAGTCTTAATTCCTTTTTTGTTATGATTTATTTGTGAGTTTACATTTTTAAATT
GTTTAACTTTCTTAATTTAGTAATTAAAAAGAGAGCATTTTACATTT

Protein Sequence

>2534 : length: 589
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMEKADGLCFNLTVI
ASSCTPQTSGLAKDAWEVARRSLCLEKKLGQGCFAEVWLGTWNGNTKVAIKTLKPGTMSP
ESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGRALKLPNLV
DMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEYTARQGAKF
PIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCP
QDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL