ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2521

Name

FUS

Synonym

ALS6|ETM4|FUS1|HNRNPP2|POMP75|TLS;FUS RNA binding protein;FUS;FUS RNA binding protein

Definition

75 kDa DNA-pairing protein|RNA-binding protein FUS|fus-like protein|fused in sarcoma|fusion gene in myxoid liposarcoma|heterogeneous nuclear ribonucleoprotein P2|oncogene FUS|oncogene TLS|translocated in liposarcoma protein

Position

16p11.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

mRNA Splicing - Major Pathway;PID Reactome;500866

Pathway

Gene Expression;Reactome;REACT:71

Pathway

mRNA Processing;Reactome;REACT:1675

Disease

Amyotrophic lateral sclerosis;KEGG DISEASE;H00058

Disease

Cancers;KEGG DISEASE

Disease

Amyotrophic lateral sclerosis 6, autosomal recessive;OMIM

Disease

Cancers of soft tissues and bone;KEGG DISEASE

Disease

Myxoid liposarcoma;KEGG DISEASE;H00049

Disease

Nervous system diseases;KEGG DISEASE

Disease

Neurodegenerative diseases;KEGG DISEASE

External Links

Links to cell senescence gene database

2521

Links to epithelial mesenchymal transition gene database

2521

Links to ovarian cancer gene database

2521

Links to endometrial cancer gene database

2521

Links to iHOP

2521

Sequence Information

Nucleotide Sequence

>2521 : length: 5119
ACTTAAGCTTCGACGCAGGAGGCGGGGCTGCTCAGTCCTCCAGGCGTCGGTACTCAGCGG
TGTTGGAACTTCGTTGCTTGCTTGCCTGTGCGCGCGTGCGCGGACATGGCCTCAAACGAT
TATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTAT
TCCCAGCAGAGCAGTCAGCCCTACGGACAGCAGAGTTACAGTGGTTATAGCCAGTCCACG
GACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAGAGCCAGAACACAGGC
TATGGAACTCAGTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAG
AGCTCCCAATCGTCTTACGGGCAGCAGTCCTCCTACCCTGGCTATGGCCAGCAGCCAGCT
CCCAGCAGCACCTCGGGAAGTTACGGTAGCAGTTCTCAGAGCAGCAGCTATGGGCAGCCC
CAGAGTGGGAGCTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAG
CAGCAAAGCTATAATCCCCCTCAGGGCTATGGACAGCAGAACCAGTACAACAGCAGCAGT
GGTGGTGGAGGTGGAGGTGGAGGTGGAGGTAACTATGGCCAAGATCAATCCTCCATGAGT
AGTGGTGGTGGCAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGC
GGTGGCTATGGACAGCAGGACCGTGGAGGCCGCGGCAGGGGTGGCAGTGGTGGCGGCGGC
GGCGGCGGCGGTGGTGGTTACAACCGCAGCAGTGGTGGCTATGAACCCAGAGGTCGTGGA
GGTGGCCGTGGAGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTT
GGTGGCCCTCGGGACCAAGGATCACGTCATGACTCCGAACAGGATAATTCAGACAACAAC
ACCATCTTTGTGCAAGGCCTGGGTGAGAATGTTACAATTGAGTCTGTGGCTGATTACTTC
AAGCAGATTGGTATTATTAAGACAAACAAGAAAACGGGACAGCCCATGATTAATTTGTAC
ACAGACAGGGAAACTGGCAAGCTGAAGGGAGAGGCAACGGTCTCTTTTGATGACCCACCT
TCAGCTAAAGCAGCTATTGACTGGTTTGATGGTAAAGAATTCTCCGGAAATCCTATCAAG
GTCTCATTTGCTACTCGCCGGGCAGACTTTAATCGGGGTGGTGGCAATGGTCGTGGAGGC
CGAGGGCGAGGAGGACCCATGGGCCGTGGAGGCTATGGAGGTGGTGGCAGTGGTGGTGGT
GGCCGAGGAGGATTTCCCAGTGGAGGTGGTGGCGGTGGAGGACAGCAGCGAGCTGGTGAC
TGGAAGTGTCCTAATCCCACCTGTGAGAATATGAACTTCTCTTGGAGGAATGAATGCAAC
CAGTGTAAGGCCCCTAAACCAGATGGCCCAGGAGGGGGACCAGGTGGCTCTCACATGGGG
GGTAACTACGGGGATGATCGTCGTGGTGGCAGAGGAGGCTATGATCGAGGCGGCTACCGG
GGCCGCGGCGGGGACCGTGGAGGCTTCCGAGGGGGCCGGGGTGGTGGGGACAGAGGTGGC
TTTGGCCCTGGCAAGATGGATTCCAGGGGTGAGCACAGACAGGATCGCAGGGAGAGGCCG
TATTAATTAGCCTGGCTCCCCAGGTTCTGGAACAGCTTTTTGTCCTGTACCCAGTGTTAC
CCTCGTTATTTTGTAACCTTCCAATTCCTGATCACCCAAGGGTTTTTTTGTGTCGGACTA
TGTAATTGTAACTATACCTCTGGTTCCCATTAAAAGTGACCATTTTAGTTAAATTTTGTT
CCTCTTCCCCCTTTTCACTTTCCTGGAAGATCGATGTCCCGATCAGGAAGGTAGAGAGTT
TTCCTGTTCAGATTACCCTGCCCAGCAGGAACTGGAATACAGTGTTCGGGGAGAAGGCCA
AATGATATCCTTGAGAGCAGAGATTAAACTTTTCTGTCATGGGGAAAGTTGGTGTATAAA
TGAGAAATGAAGAACATGGGATGTCATGAGTGTTGGCCTAAATTTGCCCAGCTATGGGGA
ATTTTTCCTTTACCACATTTATTTGCATACTGGTCTTAGTTTATTTGCAGCAGTTTATCC
CTTTTTAAGAACTCTTTGATCTTTTGGCCCTTTTAATGGTGAGGCTCAAACAAACTACAT
TTAAATGGGGCAGTATTCAGATTTGACCATGGTGGAGAGCGCTTAGCCACTCTGGGTCTT
TCACAGGAAGGAGAGTAACTGAGTGCTGCAGGAGTTTGTGGAGTGGAGTCAGGATCTAGG
AGGTGAGTGACTCCCTTCCTAGCTGCCCTGGTGAACAGCGCTTGGGTAGATACCTGCTAT
AAGGAGACTGGTCTGGCTGGGTTACTTTCACATCCTGCCTGTACTCAGAGGGCTTGAGGT
CATTGACATTATGAGATTTTAGGCTTGATCCCTTTTTGATTGGAGGGTGGAAGGCCCTCC
TAAGGGAATGATAAGTGATAAGAGGGGGAAGGGGTTGCAGCCAATGAGTTAAAACCTTAG
AGCAGTGCTCCTCAGCCTCTTACCATGTGGTTGTAAACTTGCACGTACCTGCCAACCAGT
TATTTAGCATGCTTTTTATTTTAGTTACACAGAGCGTAACATTAACCCAAGAGCAGAAAG
GTTTTATTTACAGGGTTTTCGAACTTGGTTTGTAAGACAGCTGCCATCACAAGCATAGCT
TACAAATGTGCTGGGGACCCCTAATTGGGAAGTGCTTTCCTCTCAAATTTTTATTTTTTA
TTTTTAGAGACAGAGTCTTGCTCTGTCATCCAGGCTGGAGTGCAGTGGCGTGATCTCGGC
TCACTGTAGCCTCTGCCTCCTGAGTTTAAGCGATTCTCCTGCCTCAGGAGAATCCCAGCT
TCTGAGTAGCTGAGACTACAGGCGTGGGCCACCATGCCCACCTAGTTTTTGCATTTTTAG
TGGAGGTGTGGTTTCACTGTGTTGGCCAGGCTGGTCTCTTAACTCCTGACCTCAGGTGAT
CCACCTGCCTTGGCCTCCCAAAGTGCTGGAATTACAGGCATGAGCCGCTGCATCTGGCCA
TCCTCTCAAATTTTCAAGTGTTCCACAAGTATGTTCTCTACTGAAGAGTTGCTGCATCCT
TGAATCTTGGGTGATTTGAGGCACAGAAACTATGACTTTATTTTTTGAGATGGAGTTTTG
CTCTTGTTGCCCAGGCTGGAGTGCAATGGCACGTTTTTCGGCTTACCGCAACTGCCGCCT
CCTGGGTTCAAGCGATAGCTGGGATTACAGGCATGCGCCACCATGCCCAGCTAATTTATT
TGTATTTTTAGTAGAGACGGGGTTTCTCCATGTTGGTCAGGCTGGTCTCGAACTCCCGAC
CTCAGGTGATGTGCACACCTCAGCCTCCCAATAAACCATGACTTTTAAGAGGAATAGCAG
GTTTACTTCCCCTGCCAGCATTGGGGTGCTCTCTAAGCAACAGTAGGCGGAGAGTGGTCT
GGCGTATTAAAAACAAAGGATCGTCAAGTGGGCCTTCCCAGGCATTGCTTTGACTTAGTA
CATGTAGAGGATGTGGCAGTTCTCTCCGTCCCTGCCACTGCTGGTTTCTTTGTTAAATGT
TTAGTTGAAATGGCCTGATACGATATTTGAGTAGTTCACTGTTGGTGCTTTGCCTAGCAG
GATTCTAATCTTGCTTTGGTTGTGGTCCCCTGATGCCCTCCTGTTAGGAGTGGAGGAGGT
CGAAGCTCCTTGTAAGATATGATTACTGGGACCATTAGTGTCAAGTTCCTGTGTCCTTCA
AATGGCATATGTGATTGGCCTTGACCTTAAAAGGAAATAGGGTCCCAGGTGACTGTTTAG
TGGGTAGGTCCAGTTTGGGGGGATCTTCCAGGAGAATGGATAGAGACACCTAGCAGCAGA
GAGAACATTGGTGCCTCTCAAGCCAACCTCCCACCTCAGCCTCCCAAGTAGCTGGGACTA
CAGGTGCTTCCTCGCTACCACACCTGGGTAATTTTTTTTTTAATTACTTTTTTTTTTTTA
AGAAACAGGGTTTCACTGGGTTGCCCAGGCTGGTCTTGAACTGGCCTCAAGTGACCTGCC
TGCCTCAGCCTCCCAAAGTGCTGGGATCACAGGTGTGACCCACTGCGTTTGGCCAGAATA
CTCTATTCTTACTGAATGATTGAAATCTGTCTTGAAGCATTAGGTGTCCCATTTTTGTGA
GTTGGAATTGGGACAGGCTAAGTAGGAAGTGAGGAGGGTGGGGAGAGCTGTGCTGTAGGT
CTGTTTGTCCCTTCCTTGATGTAGCCTTCAGTTAGCCCTTTCAGCTTTTTTCCCCATCTT
GTGCCGGGCCTTCCTGGGTTTCAGTACTTGGATGTAGGGCTGCAGTTATGTCAGTGGTGG
GTAGATTGACCAGGAATTAAGGTCTAGGGTCCAGCCCATGTGAGACTTGACTCACTGATC
TACCTTTAGGCATGTCTTCCTTCCAGTCTCATCCTTTTTAAATTTTTTTTTTTTTTTTGA
GACGGTCTCACTCTCACCCAGGCTGGATTGCAGTGGTGTGATCTCGACCAACTGCAACCT
CTGCCTCCCACCCGCAAGCTATCTGCCCACCTCAGCCTCTGGAGTAGCTGGGACGGGACT
ACAGGCACCTGCCACCATGACTGGCTAATTTTTTTTTGTATTTTTTGTGGAGATGGGGTC
TTGCCATGTTGCTCAGGCTGGTCTGGTCTCAAAACTGCTCTGGGCTCAAGTGATTGTCCC
ACTTTGGCCTCCCAGAGTGCTGGGATTAAGGTGTGAGATACTGTGTCCGGCTATGAAAAT
TTTATTTTTAATTAACTTGTATATATTTATGGGGTACAATGTCCTATTTCTGTACATGTA
CACATTGTGGAATCAAATCAGGCTAATATATCCATCACTTCATATCATTAGCATGAATGA
GAACATACAAAGCCACTCTTAGAAAATTTTGAAATTTATGTTATTTCAGCCCTTTTATGC
TGGAGGTTGCAAATGTTTTGTGAATAATCAGACCAAAAATAAAAACAAAAAATGATTGAC
TTCAGTCATTCAGTAAGAA

Protein Sequence

>2521 : length: 526
MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQ
SQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSS
SYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQD
QSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYE
PRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIES
VADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFS
GNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQ
QRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYD
RGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY