ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2475

Name

MTOR

Synonym

FRAP|FRAP1|FRAP2|RAFT1|RAPT1;mechanistic target of rapamycin (serine/threonine kinase);MTOR;mechanistic target of rapamycin (serine/threonine kinase)

Definition

FK506 binding protein 12-rapamycin associated protein 2|FK506-binding protein 12-rapamycin complex-associated protein 1|FKBP-rapamycin associated protein|FKBP12-rapamycin complex-associated protein 1|mammalian target of rapamycin|rapamycin and FKBP12 targ

Position

1p36.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

ctcf: first multivalent nuclear factor;PID BioCarta;100194

Pathway

Release of eIF4E;PID Reactome;500965

Pathway

Class I PI3K signaling events mediated by Akt;PID Curated;200169

Pathway

Signaling by Insulin receptor;Reactome;REACT:498

Pathway

LKB1 signaling events;PID Curated;200061

Pathway

ErbB1 downstream signaling;PID Curated;200113

Pathway

mtor signaling pathway;PID BioCarta;100101

Pathway

IL12-mediated signaling events;PID Curated;200034

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

IL4-mediated signaling events;PID Curated;200018

Pathway

Regulation of Telomerase;PID Curated;200072

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

EGFR-dependent Endothelin signaling events;PID Curated;200095

Pathway

stat3 signaling pathway;PID BioCarta;100028

Pathway

CXCR3-mediated signaling events;PID Curated;200150

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

IFN-gamma pathway;PID Curated;200110

Pathway

Adipocytokine signaling pathway;KEGG PATHWAY;hsa04920

Pathway

ErbB2/ErbB3 signaling events;PID Curated;200119

Pathway

Insulin signaling pathway;KEGG PATHWAY;hsa04910

Pathway

Hypoxia response via HIF activation;PANTHER;P00030

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

mTORC1-mediated signalling;PID Reactome;500980

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

mTOR signaling pathway;KEGG PATHWAY;hsa04150

Pathway

skeletal muscle hypertrophy is regulated via akt-mtor pathway;PID BioCarta;100137

Pathway

mTOR signaling pathway;PID Curated;200080

Pathway

CDC42 signaling events;PID Curated;200057

Pathway

Glioma;KEGG PATHWAY;hsa05214

Pathway

b cell survival pathway;PID BioCarta;100228

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

IL2 signaling events mediated by PI3K;PID Curated;200099

Pathway

Interleukin signaling pathway;PANTHER;P00036

Pathway

CXCR4-mediated signaling events;PID Curated;200083

Pathway

Type II diabetes mellitus;KEGG PATHWAY;hsa04930

Pathway

mTOR signalling;PID Reactome;500865

Pathway

S6K1-mediated signalling;PID Reactome;500921

Pathway

regulation of eif-4e and p70s6 kinase;PID BioCarta;100178

Pathway

Acute myeloid leukemia;KEGG PATHWAY;hsa05221

External Links

Links to cell senescence gene database

2475

Links to epithelial mesenchymal transition gene database

2475

Links to ovarian cancer gene database

2475

Links to endometrial cancer gene database

2475

Links to iHOP

2475

Sequence Information

Nucleotide Sequence

>2475 : length: 8754
TCCCTCGCTCCCGGCTTAGAGGACAGCGGGGAAGGCGGGCGGTGGGGCAGGGGGCCTGAA
GCGGCGGTACCGGTGCTGGCGGCGGCAGCTGAGGCCTTGGCCGAAGCCGCGCGAATATTA
AAGGAAACTTCTCTCTAAAGAACCTCAGGGCAAGATGCTTGGAACCGGACCTGCCGCCGC
CACCACCGCTGCCACCACATCTAGCAATGTGAGCGTCCTGCAGCAGTTTGCCAGTGGCCT
AAAGAGCCGGAATGAGGAAACCAGGGCCAAAGCCGCCAAGGAGCTCCAGCACTATGTCAC
CATGGAACTCCGAGAGATGAGTCAAGAGGAGTCTACTCGCTTCTATGACCAACTGAACCA
TCACATTTTTGAATTGGTTTCCAGCTCAGATGCCAATGAGAGGAAAGGTGGCATCTTGGC
CATAGCTAGCCTCATAGGAGTGGAAGGTGGGAATGCCACCCGAATTGGCAGATTTGCCAA
CTATCTTCGGAACCTCCTCCCCTCCAATGACCCAGTTGTCATGGAAATGGCATCCAAGGC
CATTGGCCGTCTTGCCATGGCAGGGGACACTTTTACCGCTGAGTACGTGGAATTTGAGGT
GAAGCGAGCCCTGGAATGGCTGGGTGCTGACCGCAATGAGGGCCGGAGACATGCAGCTGT
CCTGGTTCTCCGTGAGCTGGCCATCAGCGTCCCTACCTTCTTCTTCCAGCAAGTGCAACC
CTTCTTTGACAACATTTTTGTGGCCGTGTGGGACCCCAAACAGGCCATCCGTGAGGGAGC
TGTAGCCGCCCTTCGTGCCTGTCTGATTCTCACAACCCAGCGTGAGCCGAAGGAGATGCA
GAAGCCTCAGTGGTACAGGCACACATTTGAAGAAGCAGAGAAGGGATTTGATGAGACCTT
GGCCAAAGAGAAGGGCATGAATCGGGATGATCGGATCCATGGAGCCTTGTTGATCCTTAA
CGAGCTGGTCCGAATCAGCAGCATGGAGGGAGAGCGTCTGAGAGAAGAAATGGAAGAAAT
CACACAGCAGCAGCTGGTACACGACAAGTACTGCAAAGATCTCATGGGCTTCGGAACAAA
ACCTCGTCACATTACCCCCTTCACCAGTTTCCAGGCTGTACAGCCCCAGCAGTCAAATGC
CTTGGTGGGGCTGCTGGGGTACAGCTCTCACCAAGGCCTCATGGGATTTGGGACCTCCCC
CAGTCCAGCTAAGTCCACCCTGGTGGAGAGCCGGTGTTGCAGAGACTTGATGGAGGAGAA
ATTTGATCAGGTGTGCCAGTGGGTGCTGAAATGCAGGAATAGCAAGAACTCGCTGATCCA
AATGACAATCCTTAATTTGTTGCCCCGCTTGGCTGCATTCCGACCTTCTGCCTTCACAGA
TACCCAGTATCTCCAAGATACCATGAACCATGTCCTAAGCTGTGTCAAGAAGGAGAAGGA
ACGTACAGCGGCCTTCCAAGCCCTGGGGCTACTTTCTGTGGCTGTGAGGTCTGAGTTTAA
GGTCTATTTGCCTCGCGTGCTGGACATCATCCGAGCGGCCCTGCCCCCAAAGGACTTCGC
CCATAAGAGGCAGAAGGCAATGCAGGTGGATGCCACAGTCTTCACTTGCATCAGCATGCT
GGCTCGAGCAATGGGGCCAGGCATCCAGCAGGATATCAAGGAGCTGCTGGAGCCCATGCT
GGCAGTGGGACTAAGCCCTGCCCTCACTGCAGTGCTCTACGACCTGAGCCGTCAGATTCC
ACAGCTAAAGAAGGACATTCAAGATGGGCTACTGAAAATGCTGTCCCTGGTCCTTATGCA
CAAACCCCTTCGCCACCCAGGCATGCCCAAGGGCCTGGCCCATCAGCTGGCCTCTCCTGG
CCTCACGACCCTCCCTGAGGCCAGCGATGTGGGCAGCATCACTCTTGCCCTCCGAACGCT
TGGCAGCTTTGAATTTGAAGGCCACTCTCTGACCCAATTTGTTCGCCACTGTGCGGATCA
TTTCCTGAACAGTGAGCACAAGGAGATCCGCATGGAGGCTGCCCGCACCTGCTCCCGCCT
GCTCACACCCTCCATCCACCTCATCAGTGGCCATGCTCATGTGGTTAGCCAGACCGCAGT
GCAAGTGGTGGCAGATGTGCTTAGCAAACTGCTCGTAGTTGGGATAACAGATCCTGACCC
TGACATTCGCTACTGTGTCTTGGCGTCCCTGGACGAGCGCTTTGATGCACACCTGGCCCA
GGCGGAGAACTTGCAGGCCTTGTTTGTGGCTCTGAATGACCAGGTGTTTGAGATCCGGGA
GCTGGCCATCTGCACTGTGGGCCGACTCAGTAGCATGAACCCTGCCTTTGTCATGCCTTT
CCTGCGCAAGATGCTCATCCAGATTTTGACAGAGTTGGAGCACAGTGGGATTGGAAGAAT
CAAAGAGCAGAGTGCCCGCATGCTGGGGCACCTGGTCTCCAATGCCCCCCGACTCATCCG
CCCCTACATGGAGCCTATTCTGAAGGCATTAATTTTGAAACTGAAAGATCCAGACCCTGA
TCCAAACCCAGGTGTGATCAATAATGTCCTGGCAACAATAGGAGAATTGGCACAGGTTAG
TGGCCTGGAAATGAGGAAATGGGTTGATGAACTTTTTATTATCATCATGGACATGCTCCA
GGATTCCTCTTTGTTGGCCAAAAGGCAGGTGGCTCTGTGGACCCTGGGACAGTTGGTGGC
CAGCACTGGCTATGTAGTAGAGCCCTACAGGAAGTACCCTACTTTGCTTGAGGTGCTACT
GAATTTTCTGAAGACTGAGCAGAACCAGGGTACACGCAGAGAGGCCATCCGTGTGTTAGG
GCTTTTAGGGGCTTTGGATCCTTACAAGCACAAAGTGAACATTGGCATGATAGACCAGTC
CCGGGATGCCTCTGCTGTCAGCCTGTCAGAATCCAAGTCAAGTCAGGATTCCTCTGACTA
TAGCACTAGTGAAATGCTGGTCAACATGGGAAACTTGCCTCTGGATGAGTTCTACCCAGC
TGTGTCCATGGTGGCCCTGATGCGGATCTTCCGAGACCAGTCACTCTCTCATCATCACAC
CATGGTTGTCCAGGCCATCACCTTCATCTTCAAGTCCCTGGGACTCAAATGTGTGCAGTT
CCTGCCCCAGGTCATGCCCACGTTCCTTAACGTCATTCGAGTCTGTGATGGGGCCATCCG
GGAATTTTTGTTCCAGCAGCTGGGAATGTTGGTGTCCTTTGTGAAGAGCCACATCAGACC
TTATATGGATGAAATAGTCACCCTCATGAGAGAATTCTGGGTCATGAACACCTCAATTCA
GAGCACGATCATTCTTCTCATTGAGCAAATTGTGGTAGCTCTTGGGGGTGAATTTAAGCT
CTACCTGCCCCAGCTGATCCCACACATGCTGCGTGTCTTCATGCATGACAACAGCCCAGG
CCGCATTGTCTCTATCAAGTTACTGGCTGCAATCCAGCTGTTTGGCGCCAACCTGGATGA
CTACCTGCATTTACTGCTGCCTCCTATTGTTAAGTTGTTTGATGCCCCTGAAGCTCCACT
GCCATCTCGAAAGGCAGCGCTAGAGACTGTGGACCGCCTGACGGAGTCCCTGGATTTCAC
TGACTATGCCTCCCGGATCATTCACCCTATTGTTCGAACACTGGACCAGAGCCCAGAACT
GCGCTCCACAGCCATGGACACGCTGTCTTCACTTGTTTTTCAGCTGGGGAAGAAGTACCA
AATTTTCATTCCAATGGTGAATAAAGTTCTGGTGCGACACCGAATCAATCATCAGCGCTA
TGATGTGCTCATCTGCAGAATTGTCAAGGGATACACACTTGCTGATGAAGAGGAGGATCC
TTTGATTTACCAGCATCGGATGCTTAGGAGTGGCCAAGGGGATGCATTGGCTAGTGGACC
AGTGGAAACAGGACCCATGAAGAAACTGCACGTCAGCACCATCAACCTCCAAAAGGCCTG
GGGCGCTGCCAGGAGGGTCTCCAAAGATGACTGGCTGGAATGGCTGAGACGGCTGAGCCT
GGAGCTGCTGAAGGACTCATCATCGCCCTCCCTGCGCTCCTGCTGGGCCCTGGCACAGGC
CTACAACCCGATGGCCAGGGATCTCTTCAATGCTGCATTTGTGTCCTGCTGGTCTGAACT
GAATGAAGATCAACAGGATGAGCTCATCAGAAGCATCGAGTTGGCCCTCACCTCACAAGA
CATCGCTGAAGTCACACAGACCCTCTTAAACTTGGCTGAATTCATGGAACACAGTGACAA
GGGCCCCCTGCCACTGAGAGATGACAATGGCATTGTTCTGCTGGGTGAGAGAGCTGCCAA
GTGCCGAGCATATGCCAAAGCACTACACTACAAAGAACTGGAGTTCCAGAAAGGCCCCAC
CCCTGCCATTCTAGAATCTCTCATCAGCATTAATAATAAGCTACAGCAGCCGGAGGCAGC
GGCCGGAGTGTTAGAATATGCCATGAAACACTTTGGAGAGCTGGAGATCCAGGCTACCTG
GTATGAGAAACTGCACGAGTGGGAGGATGCCCTTGTGGCCTATGACAAGAAAATGGACAC
CAACAAGGACGACCCAGAGCTGATGCTGGGCCGCATGCGCTGCCTCGAGGCCTTGGGGGA
ATGGGGTCAACTCCACCAGCAGTGCTGTGAAAAGTGGACCCTGGTTAATGATGAGACCCA
AGCCAAGATGGCCCGGATGGCTGCTGCAGCTGCATGGGGTTTAGGTCAGTGGGACAGCAT
GGAAGAATACACCTGTATGATCCCTCGGGACACCCATGATGGGGCATTTTATAGAGCTGT
GCTGGCACTGCATCAGGACCTCTTCTCCTTGGCACAACAGTGCATTGACAAGGCCAGGGA
CCTGCTGGATGCTGAATTAACTGCGATGGCAGGAGAGAGTTACAGTCGGGCATATGGGGC
CATGGTTTCTTGCCACATGCTGTCCGAGCTGGAGGAGGTTATCCAGTACAAACTTGTCCC
CGAGCGACGAGAGATCATCCGCCAGATCTGGTGGGAGAGACTGCAGGGCTGCCAGCGTAT
CGTAGAGGACTGGCAGAAAATCCTTATGGTGCGGTCCCTTGTGGTCAGCCCTCATGAAGA
CATGAGAACCTGGCTCAAGTATGCAAGCCTGTGCGGCAAGAGTGGCAGGCTGGCTCTTGC
TCATAAAACTTTAGTGTTGCTCCTGGGAGTTGATCCGTCTCGGCAACTTGACCATCCTCT
GCCAACAGTTCACCCTCAGGTGACCTATGCCTACATGAAAAACATGTGGAAGAGTGCCCG
CAAGATCGATGCCTTCCAGCACATGCAGCATTTTGTCCAGACCATGCAGCAACAGGCCCA
GCATGCCATCGCTACTGAGGACCAGCAGCATAAGCAGGAACTGCACAAGCTCATGGCCCG
ATGCTTCCTGAAACTTGGAGAGTGGCAGCTGAATCTACAGGGCATCAATGAGAGCACAAT
CCCCAAAGTGCTGCAGTACTACAGCGCCGCCACAGAGCACGACCGCAGCTGGTACAAGGC
CTGGCATGCGTGGGCAGTGATGAACTTCGAAGCTGTGCTACACTACAAACATCAGAACCA
AGCCCGCGATGAGAAGAAGAAACTGCGTCATGCCAGCGGGGCCAACATCACCAACGCCAC
CACTGCCGCCACCACGGCCGCCACTGCCACCACCACTGCCAGCACCGAGGGCAGCAACAG
TGAGAGCGAGGCCGAGAGCACCGAGAACAGCCCCACCCCATCGCCGCTGCAGAAGAAGGT
CACTGAGGATCTGTCCAAAACCCTCCTGATGTACACGGTGCCTGCCGTCCAGGGCTTCTT
CCGTTCCATCTCCTTGTCACGAGGCAACAACCTCCAGGATACACTCAGAGTTCTCACCTT
ATGGTTTGATTATGGTCACTGGCCAGATGTCAATGAGGCCTTAGTGGAGGGGGTGAAAGC
CATCCAGATTGATACCTGGCTACAGGTTATACCTCAGCTCATTGCAAGAATTGATACGCC
CAGACCCTTGGTGGGACGTCTCATTCACCAGCTTCTCACAGACATTGGTCGGTACCACCC
CCAGGCCCTCATCTACCCACTGACAGTGGCTTCTAAGTCTACCACGACAGCCCGGCACAA
TGCAGCCAACAAGATTCTGAAGAACATGTGTGAGCACAGCAACACCCTGGTCCAGCAGGC
CATGATGGTGAGCGAGGAGCTGATCCGAGTGGCCATCCTCTGGCATGAGATGTGGCATGA
AGGCCTGGAAGAGGCATCTCGTTTGTACTTTGGGGAAAGGAACGTGAAAGGCATGTTTGA
GGTGCTGGAGCCCTTGCATGCTATGATGGAACGGGGCCCCCAGACTCTGAAGGAAACATC
CTTTAATCAGGCCTATGGTCGAGATTTAATGGAGGCCCAAGAGTGGTGCAGGAAGTACAT
GAAATCAGGGAATGTCAAGGACCTCACCCAAGCCTGGGACCTCTATTATCATGTGTTCCG
ACGAATCTCAAAGCAGCTGCCTCAGCTCACATCCTTAGAGCTGCAATATGTTTCCCCAAA
ACTTCTGATGTGCCGGGACCTTGAATTGGCTGTGCCAGGAACATATGACCCCAACCAGCC
AATCATTCGCATTCAGTCCATAGCACCGTCTTTGCAAGTCATCACATCCAAGCAGAGGCC
CCGGAAATTGACACTTATGGGCAGCAACGGACATGAGTTTGTTTTCCTTCTAAAAGGCCA
TGAAGATCTGCGCCAGGATGAGCGTGTGATGCAGCTCTTCGGCCTGGTTAACACCCTTCT
GGCCAATGACCCAACATCTCTTCGGAAAAACCTCAGCATCCAGAGATACGCTGTCATCCC
TTTATCGACCAACTCGGGCCTCATTGGCTGGGTTCCCCACTGTGACACACTGCACGCCCT
CATCCGGGACTACAGGGAGAAGAAGAAGATCCTTCTCAACATCGAGCATCGCATCATGTT
GCGGATGGCTCCGGACTATGACCACTTGACTCTGATGCAGAAGGTGGAGGTGTTTGAGCA
TGCCGTCAATAATACAGCTGGGGACGACCTGGCCAAGCTGCTGTGGCTGAAAAGCCCCAG
CTCCGAGGTGTGGTTTGACCGAAGAACCAATTATACCCGTTCTTTAGCGGTCATGTCAAT
GGTTGGGTATATTTTAGGCCTGGGAGATAGACACCCATCCAACCTGATGCTGGACCGTCT
GAGTGGGAAGATCCTGCACATTGACTTTGGGGACTGCTTTGAGGTTGCTATGACCCGAGA
GAAGTTTCCAGAGAAGATTCCATTTAGACTAACAAGAATGTTGACCAATGCTATGGAGGT
TACAGGCCTGGATGGCAACTACAGAATCACATGCCACACAGTGATGGAGGTGCTGCGAGA
GCACAAGGACAGTGTCATGGCCGTGCTGGAAGCCTTTGTCTATGACCCCTTGCTGAACTG
GAGGCTGATGGACACAAATACCAAAGGCAACAAGCGATCCCGAACGAGGACGGATTCCTA
CTCTGCTGGCCAGTCAGTCGAAATTTTGGACGGTGTGGAACTTGGAGAGCCAGCCCATAA
GAAAACGGGGACCACAGTGCCAGAATCTATTCATTCTTTCATTGGAGACGGTTTGGTGAA
ACCAGAGGCCCTAAATAAGAAAGCTATCCAGATTATTAACAGGGTTCGAGATAAGCTCAC
TGGTCGGGACTTCTCTCATGATGACACTTTGGATGTTCCAACGCAAGTTGAGCTGCTCAT
CAAACAAGCGACATCCCATGAAAACCTCTGCCAGTGCTATATTGGCTGGTGCCCTTTCTG
GTAACTGGAGGCCCAGATGTGCCCATCACGTTTTTTCTGAGGCTTTTGTACTTTAGTAAA
TGCTTCCACTAAACTGAAACCATGGTGAGAAAGTTTGACTTTGTTAAATATTTTGAAATG
TAAATGAAAAGAACTACTGTATATTAAAAGTTGGTTTGAACCAACTTTCTAGCTGCTGTT
GAAGAATATATTGTCAGAAACACAAGGCTTGATTTGGTTCCCAGGACAGTGAAACATAGT
AATACCACGTAAATCAAGCCATTCATTTTGGGGAACAGAAGATCCATAACTTTAGAAATA
CGGGTTTTGACTTAACTCACAAGAGAACTCATCATAAGTACTTGCTGATGGAAGAATGAC
CTAGTTGCTCCTCTCAACATGGGTACAGCAAACTCAGCACAGCCAAGAAGCCTCAGGTCG
TGGAGAACATGGATTAGGATCCTAGACTGTAAAGACACAGAAGATGCTGACCTCACCCCT
GCCACCTATCCCAAGACCTCACTGGTCTGTGGACAGCAGCAGAAATGTTTGCAAGATAGG
CCAAAATGAGTACAAAAGGTCTGTCTTCCATCAGACCCAGTGATGCTGCGACTCACACGC
TTCAATTCAAGACCTGACCGCTAGTAGGGAGGTTTATTCAGATCGCTGGCAGCCTCGGCT
GAGCAGATGCACAGAGGGGATCACTGTGCAGTGGGACCACCCTCACTGGCCTTCTGCAGC
AGGGTTCTGGGATGTTTTCAGTGGTCAAAATACTCTGTTTAGAGCAAGGGCTCAGAAAAC
AGAAATACTGTCATGGAGGTGCTGAACACAGGGAAGGTCTGGTACATATTGGAAATTATG
AGCAGAACAAATACTCAACTAAATGCACAAAGTATAAAGTGTAGCCATGTCTAGACACCA
TGTTGTATCAGAATAATTTTTGTGCCAATAAATGACATCAGAATTTTAAACATA

Protein Sequence

>2475 : length: 2549
MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGTSPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEAPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNATTAATTAATATTTASTEGSNSESEAESTENSP
TPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVN
EALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVAS
KSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFG
ERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSL
QVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNL
SIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTL
MQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRH
PSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITC
HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDG
VELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLD
VPTQVELLIKQATSHENLCQCYIGWCPFW