ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

23598

Name

PATZ1

Synonym

MAZR|PATZ|RIAZ|ZBTB19|ZNF278|ZSG|dJ400N23;POZ (BTB) and AT hook containing zinc finger 1;PATZ1;POZ (BTB) and AT hook containing zinc finger 1

Definition

BTB-POZ domain zinc finger transcription factor|BTB/POZ domain zinc finger transcription factor|MAZ-related factor|POZ-, AT hook-, and zinc finger-containing protein 1|POZ-AT hook-zinc finger protein|protein kinase A RI subunit alpha-associated protein|zi

Position

22q12.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Coregulation of Androgen receptor activity;PID Curated;200038

External Links

Links to cell senescence gene database

23598

Links to epithelial mesenchymal transition gene database

23598

Links to ovarian cancer gene database

23598

Links to endometrial cancer gene database

23598

Links to iHOP

23598

Sequence Information

Nucleotide Sequence

>23598 : length: 3812
GGGCCTACTCTGCCGCCGCCGCCGCCCGCCCGCTCCAGCCGCCGCCGCCGCCGCCACCGC
CCTCCAGGCTCCGGGACCCGGCCCGCGCCACCGCCCCCGTGCGCGCCCCGCCGCCGCCGC
CTTCGCCTTCGCCTTTTGTTTCCTCCGCTCCGGCGCCCCCGCCCCGGCTCGCGCTTTGCA
GGGGACGCAGCGCGCGCCCCCAGCGGGCCCGGGAAAAGCCGCGGCGCGCGCGCGCGCCTG
CGCGGCGGACCCCTCCTTCTCCTCCCCGCGTGCGCGTGCCCTTCTTGGCTGCGCGCCGGC
GCCGCCTGGCGGGCGGGAGGGGAGGTGGCAGGCGCGTTTGCAGGAGGGGCGCACCTCTTC
GCTCGCGCACCCCCCCGGAAGGTAGACCGGGAAGGGGAGGCGGGCGGGCGGAGAGGAGAG
AGTGGCGCGCAGTCCAGCGAGGGCGGGGGTTGGCTATGTGGGGGGTGGTGCACCCCGCAG
TCTAGACAGTCTGATCCGGGCTGGGGGCGTGTACACTCGGCGCACCTGCGAGACTACAGA
GCCTCGGGCCGGCACGTGTGGGGAGTGTGGACACGTCTGCTGCGCCCCGCTTCTCGCTGC
TGAGGGGAAGGGAGGGGGCGGGCAGGTGCAGCGGCCGGGCTAGTGGGAGGGGGCGGCGGC
CATGGAGCGGGTGAACGACGCTTCGTGCGGCCCGTCTGGCTGCTACACATACCAGGTGAG
CAGACACAGCACGGAGATGCTGCACAACCTGAACCAGCAGCGCAAAAACGGCGGGCGCTT
CTGCGACGTGCTCTTGCGGGTAGGCGACGAGAGCTTCCCAGCGCACCGCGCCGTGCTGGC
CGCCTGCAGCGAGTACTTTGAGTCGGTGTTCAGCGCCCAGTTGGGCGACGGCGGAGCTGC
GGACGGGGGTCCGGCTGATGTAGGGGGCGCGACGGCAGCACCAGGCGGCGGGGCCGGGGG
CAGCCGGGAGCTGGAGATGCACACTATCAGCTCCAAGGTATTTGGGGACATTCTGGACTT
CGCCTACACTTCCCGCATCGTGGTGCGCTTGGAGAGCTTTCCCGAACTCATGACGGCCGC
CAAGTTCCTGCTGATGAGGTCGGTTATCGAGATCTGCCAGGAAGTCATCAAACAGTCCAA
CGTACAGATCCTGGTACCCCCTGCCCGCGCCGATATAATGCTCTTTCGCCCCCCTGGGAC
CTCGGACTTGGGCTTCCCTTTGGACATGACCAACGGGGCAGCCTTGGCAGCCAACAGCAA
TGGCATCGCCGGCAGCATGCAGCCAGAGGAGGAGGCAGCTCGGGCGGCTGGTGCAGCCAT
TGCAGGCCAAGCCTCTTTGCCTGTGTTACCTGGGGTGGACCGCTTGCCCATGGTGGCTGG
ACCCCTATCCCCCCAACTGCTGACTTCCCCATTCCCCAGTGTGGCATCCAGTGCCCCTCC
CCTGACTGGCAAGCGAGGCCGGGGCCGCCCAAGGAAGGCCAACCTGCTGGACTCAATGTT
TGGGTCCCCAGGGGGCCTGAGGGAGGCAGGCATCCTTCCATGCGGTCTATGTGGTAAGGT
GTTCACTGATGCCAACCGGCTCCGGCAGCACGAGGCCCAGCACGGTGTCACCAGCCTCCA
GCTGGGCTACATCGACCTTCCTCCTCCGAGGCTGGGTGAGAATGGGCTACCCATCTCTGA
AGACCCCGACGGCCCCCGAAAGAGGAGCCGGACCAGGAAGCAGGTGGCTTGTGAGATCTG
CGGCAAGATCTTCCGTGATGTGTATCATCTTAACCGGCACAAGCTGTCCCACTCTGGGGA
GAAGCCCTACTCCTGCCCTGTGTGTGGGTTGCGGTTCAAGAGAAAAGACCGCATGTCCTA
CCATGTGCGGTCCCATGATGGGTCCGTGGGCAAGCCTTACATCTGCCAGAGCTGTGGGAA
AGGCTTCTCCAGGCCTGATCACTTGAACGGACATATCAAGCAGGTGCACACTTCTGAGCG
GCCTCACAAGTGTCAGACCTGCAATGCTTCTTTTGCCACCCGAGACCGTCTGCGCTCCCA
CCTGGCCTGTCATGAAGACAAGGTGCCCTGCCAGGTGTGTGGGAAGTACTTGCGGGCAGC
ATACATGGCAGACCACCTGAAGAAGCACAGCGAGGGGCCCAGCAACTTCTGCAGTATCTG
TAACCGAGGTTTCTCCTCTGCCTCCTACTTAAAGGTCCATGTTAAAACCCACCACGGTGT
TCCCCTTCCCCAGGTCTCCAGGCACCAGGAGCCCATCCTGAATGGGGGAGCAGCGTTCCA
CTGCGCCAGGACCTATGGCAACAAAGAAGGCCAGAAATGCTCACATCAGGATCCGATTGA
GAGCTCTGACTCCTATGGTGACCTCTCAGATGCCAGCGACCTGAAGACGCCAGAGAAGCA
GAGTGCCAATGGCTCTTTCTCCTGCGACATGGCAGTCCCCAAAAACAAAATGGAGTCTGA
TGGGGAGAAGAAGTACCCATGCCCTGAATGTGGGAGCTTCTTCCGCTCTAAGTCCTACTT
GAACAAACACATCCAGAAGGTGCATGTCCGGGCTCTCGGGGGCCCCCTGGGGGACCTGGG
CCCTGCCCTTGGCTCACCTTTCTCTCCTCAGCAGAACATGTCTCTCCTCGAGTCCTTTGG
GTTTCAGATTGTTCAGTCGGCATTTGCGTCATCTTTAGTAGATCCTGAGGTTGACCAGCA
GCCCATGGGGCCTGAAGGGAAATGAGGCAGCTGCTGTGTCCCCACGGAAACAACCATCTG
GGGACTGCTGGGAAATGCTGTGAATGCGGAGGGAAGTGATGTTTGGGTTCTGTAGCTGAG
AGATTTTTATTCATTTTTAACTGCCCCCCAACCCCACTCCAACTCCTTCTCCACCACCCA
TTCTCCCAATGGTCTTTAGAAATAGATTTTCATCTGATATTCTGCAGAAATATCAATGAG
ACTTGGTATGGGACAGGGGCAGAAAACACTACATAGGCCTCCAAGGCAAAACCAGTCCCA
GTTTCTTTAATGGGAAGAAGCTGGAATTCCTGGTGCTCAATTCTTAGTGACCCCAATCCT
ATACCCAAATCTATGATATTCTGGGACCTCAGTGATTTTGGTCCCCTCCCACTTCTCTAG
TTCGTCATCCTCCCTTCCCATATCCTTCAAAAGAACCACACTAGGGTCTCCACCTACTTA
TACAATGCGGATGCCCAACTGTTTTTAAGGAAGCCAGAAGCATCCCATGGACCATGGGGT
GAGTGTCCTCCAAGAGCCCCCTGAGCTCAGCCCTCTGCCTGGAGGGCTCCAGACCTTTCT
GAGCCCTGCTTGGAGGCGAGCATTTTCACTGCTAGGACAAGCTCAGCTGTTGAGGACACC
CCCACCCCAAATTTCAGTTCTTACGTGATTTTAACCATTCAACATGCTGTTGGGTTTTAA
TTCTCTAATTATTATTATTATTGTTATTATTTTTTAGGACCAGTTGTAGTGAATTGCTAC
TGAAAGCTATCCCAGGTGATACAGAGCTCTTTGTAAACCGCAGTCACACATTAGGGTTAG
TATTAAACTTTGTTTAGATGTACCATAATTAACTTGGCTAGTTGATTGTTTGAAGTCTAT
GGAAGAAATAGTTTTATGCAAAATTTTAAAAAATGCCAGTCTGGTCAGGGAAGTAGGGGG
TTTCAATGCTGTTGGGAACCAGGAAGGTGGGACAGCCGGCAGGTAGGGACATTGTGTACC
TCAGTTGTGTCACATGTGAGCAAGCCCAGGTTGACCTTGTGATGTGAATTGATCTGATCA
GACTGTATTAAAAATGTTAGTACATTACTCTA

Protein Sequence

>23598 : length: 687
MERVNDASCGPSGCYTYQVSRHSTEMLHNLNQQRKNGGRFCDVLLRVGDESFPAHRAVLA
ACSEYFESVFSAQLGDGGAADGGPADVGGATAAPGGGAGGSRELEMHTISSKVFGDILDF
AYTSRIVVRLESFPELMTAAKFLLMRSVIEICQEVIKQSNVQILVPPARADIMLFRPPGT
SDLGFPLDMTNGAALAANSNGIAGSMQPEEEAARAAGAAIAGQASLPVLPGVDRLPMVAG
PLSPQLLTSPFPSVASSAPPLTGKRGRGRPRKANLLDSMFGSPGGLREAGILPCGLCGKV
FTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSRTRKQVACEIC
GKIFRDVYHLNRHKLSHSGEKPYSCPVCGLRFKRKDRMSYHVRSHDGSVGKPYICQSCGK
GFSRPDHLNGHIKQVHTSERPHKCQTCNASFATRDRLRSHLACHEDKVPCQVCGKYLRAA
YMADHLKKHSEGPSNFCSICNRGFSSASYLKVHVKTHHGVPLPQVSRHQEPILNGGAAFH
CARTYGNKEGQKCSHQDPIESSDSYGDLSDASDLKTPEKQSANGSFSCDMAVPKNKMESD
GEKKYPCPECGSFFRSKSYLNKHIQKVHVRALGGPLGDLGPALGSPFSPQQNMSLLESFG
FQIVQSAFASSLVDPEVDQQPMGPEGK