ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

23532

Name

PRAME

Synonym

CT130|MAPE|OIP-4|OIP4;preferentially expressed antigen in melanoma;PRAME;preferentially expressed antigen in melanoma

Definition

Opa-interacting protein OIP4|cancer/testis antigen 130|melanoma antigen preferentially expressed in tumors|opa-interacting protein 4|preferentially expressed antigen of melanoma

Position

22q11.22

Gene Type

protein-coding

External Links

Links to cell senescence gene database

23532

Links to epithelial mesenchymal transition gene database

23532

Links to ovarian cancer gene database

23532

Links to endometrial cancer gene database

23532

Links to iHOP

23532

Sequence Information

Nucleotide Sequence

>23532 : length: 2845
AGAGGGCCTGGGAGGAAGTGGGTTTTGCATACAGTCCCTGTTGACTCTAGTGCCCCCTGC
TGGCCCCAGACGCGAGTTCCGGCGAGGCTTCAGGGTACAGCTCCCCCGCAGCCAGAAGCC
GGGCCTGCAGCGCCTCAGCACCGCTCCGGGACACCCCACCCGCTTCCCAGGCGTGACCTG
TCAACAGCAACTTCGCGGTGTGGTGAACTCTCTGAGGAAAAACGTAAGTTCGAGCCCTGA
TTCCTCCGCTTCCCCGCAGGGTGACCTTGGGCTTGTGCCCCCAGCACCACCCCTGTCCCG
GGTCCCTGTTTTCTCTCTGGAAATGGGTTGAAGACCAAAGAAAATAATGTGCGCCACTTG
GGTCACCCCGGGCCGCCTGCCCCGGAAAATTGGCCCCAGTTGAGGAGTTGTGGCTGTAAG
GATGCCTTGAACCGAGGCGGCGGTGCTCGTGGTTGGAGCTCTCCAGGGTGGGTGCGCATT
TGTAATGCGGTGGATGCTCTGGGACTCGGCCCCTCTGAAGGTGCTGGGGGTTGGGGACGG
CCCAGGCAGTGGCGTAGGCGTCCTAGGAAGGCGGGAGCAGAGGCAGAAATGTCGCTGCAA
GACCGTAGTCAGGGTCCTTGACCACAGGGGTCACTTGTGACCAACCACATGGTCTGTTGT
TCCTCCTGCCCCCTGGTTCAGCCCAGGAAACACTGGTGCTCAGGTTTGGAGCCAGAGATT
TGCACTGAAAGGGCGGGATTGAGTCGCCAGTTGTCAGTTTCCTCAGCAGTATTTGCGGAG
GTTTTCACAGGAGGCCGTTGCTTCGTAAATATTATACATGTATTCTTCTTTTTGGAGCAT
TTTGATTATTACTCTCAGACGTGCGTGGCAACAAGTGACTGAGACCTAGAAATCCAAGCG
TTGGAGGTCCTGAGGCCAGCCTAAGTCGCTTCAAAATGGAACGAAGGCGTTTGTGGGGTT
CCATTCAGAGCCGATACATCAGCATGAGTGTGTGGACAAGCCCACGGAGACTTGTGGAGC
TGGCAGGGCAGAGCCTGCTGAAGGATGAGGCCCTGGCCATTGCCGCCCTGGAGTTGCTGC
CCAGGGAGCTCTTCCCGCCACTCTTCATGGCAGCCTTTGACGGGAGACACAGCCAGACCC
TGAAGGCAATGGTGCAGGCCTGGCCCTTCACCTGCCTCCCTCTGGGAGTGCTGATGAAGG
GACAACATCTTCACCTGGAGACCTTCAAAGCTGTGCTTGATGGACTTGATGTGCTCCTTG
CCCAGGAGGTTCGCCCCAGGAGGTGGAAACTTCAAGTGCTGGATTTACGGAAGAACTCTC
ATCAGGACTTCTGGACTGTATGGTCTGGAAACAGGGCCAGTCTGTACTCATTTCCAGAGC
CAGAAGCAGCTCAGCCCATGACAAAGAAGCGAAAAGTAGATGGTTTGAGCACAGAGGCAG
AGCAGCCCTTCATTCCAGTAGAGGTGCTCGTAGACCTGTTCCTCAAGGAAGGTGCCTGTG
ATGAATTGTTCTCCTACCTCATTGAGAAAGTGAAGCGAAAGAAAAATGTACTACGCCTGT
GCTGTAAGAAGCTGAAGATTTTTGCAATGCCCATGCAGGATATCAAGATGATCCTGAAAA
TGGTGCAGCTGGACTCTATTGAAGATTTGGAAGTGACTTGTACCTGGAAGCTACCCACCT
TGGCGAAATTTTCTCCTTACCTGGGCCAGATGATTAATCTGCGTAGACTCCTCCTCTCCC
ACATCCATGCATCTTCCTACATTTCCCCGGAGAAGGAAGAGCAGTATATCGCCCAGTTCA
CCTCTCAGTTCCTCAGTCTGCAGTGCCTGCAGGCTCTCTATGTGGACTCTTTATTTTTCC
TTAGAGGCCGCCTGGATCAGTTGCTCAGGCACGTGATGAACCCCTTGGAAACCCTCTCAA
TAACTAACTGCCGGCTTTCGGAAGGGGATGTGATGCATCTGTCCCAGAGTCCCAGCGTCA
GTCAGCTAAGTGTCCTGAGTCTAAGTGGGGTCATGCTGACCGATGTAAGTCCCGAGCCCC
TCCAAGCTCTGCTGGAGAGAGCCTCTGCCACCCTCCAGGACCTGGTCTTTGATGAGTGTG
GGATCACGGATGATCAGCTCCTTGCCCTCCTGCCTTCCCTGAGCCACTGCTCCCAGCTTA
CGACCTTAAGCTTCTACGGGAATTCCATCTCCATATCTGCCCTGCAGAGTCTCCTGCAGC
ACCTCATCGGGCTGAGCAATCTGACCCACGTGCTGTATCCTGTCCCCCTGGAGAGTTATG
AGGACATCCATGGTACCCTCCACCTGGAGAGGCTTGCCTATCTGCATGCCAGGCTCAGGG
AGTTGCTGTGTGAGTTGGGGCGGCCCAGCATGGTCTGGCTTAGTGCCAACCCCTGTCCTC
ACTGTGGGGACAGAACCTTCTATGACCCGGAGCCCATCCTGTGCCCCTGTTTCATGCCTA
ATTAGCTGGGTGCACATATCAAATGCTTCATTCTGCATACTTGGACACTAAAGCCAGGAT
GTGCATGCATCTTGAAGCAACAAAGCAGCCACAGTTTCAGACAAATGTTCAGTGTGAGTG
AGGAAAACATGTTCAGTGAGGAAAAAACATTCAGACAAATGTTCAGTGAGGAAAAAAAGG
GGAAGTTGGGGGTAGGCAGATGTTGACTTGAGGAGTTAATGTGATCTTTGGGGAGATACA
TCTTATAGAGTTAGAAATAGAATCTGAATTTCTAAAGGGAGATTCTGGCTTGGGAAGTAC
ATGTAGGAGTTAATCCCTGTGTAGACTGTTGTAAAGAAACTGTTGAAAATAAAGAGAAGC
AATGTGAAGCACCTGGAAAAAAAAA

Protein Sequence

>23532 : length: 509
MERRRLWGSIQSRYISMSVWTSPRRLVELAGQSLLKDEALAIAALELLPRELFPPLFMAA
FDGRHSQTLKAMVQAWPFTCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRWKLQ
VLDLRKNSHQDFWTVWSGNRASLYSFPEPEAAQPMTKKRKVDGLSTEAEQPFIPVEVLVD
LFLKEGACDELFSYLIEKVKRKKNVLRLCCKKLKIFAMPMQDIKMILKMVQLDSIEDLEV
TCTWKLPTLAKFSPYLGQMINLRRLLLSHIHASSYISPEKEEQYIAQFTSQFLSLQCLQA
LYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVM
LTDVSPEPLQALLERASATLQDLVFDECGITDDQLLALLPSLSHCSQLTTLSFYGNSISI
SALQSLLQHLIGLSNLTHVLYPVPLESYEDIHGTLHLERLAYLHARLRELLCELGRPSMV
WLSANPCPHCGDRTFYDPEPILCPCFMPN