ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2353

Name

FOS

Synonym

AP-1|C-FOS|p55;FBJ murine osteosarcoma viral oncogene homolog;FOS;FBJ murine osteosarcoma viral oncogene homolog

Definition

FBJ murine osteosarcoma viral (v-fos) oncogene homolog (oncogene FOS)|G0/G1 switch regulatory protein 7|activator protein 1|cellular oncogene c-fos|proto-oncogene c-Fos

Position

14q24.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

pertussis toxin-insensitive ccr5 signaling in macrophage;PID BioCarta;100214

Pathway

il-2 receptor beta chain in t cell activation;PID BioCarta;100129

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

LPA receptor mediated events;PID Curated;200011

Pathway

Ras signaling in the CD4+ TCR pathway;PID Curated;200088

Pathway

B cell receptor signaling pathway;KEGG PATHWAY;hsa04662

Pathway

ErbB2/ErbB3 signaling events;PID Curated;200119

Pathway

igf-1 signaling pathway;PID BioCarta;100136

Pathway

Angiogenesis;PANTHER;P00005

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

HIF-1-alpha transcription factor network;PID Curated;200172

Pathway

IL12 signaling mediated by STAT4;PID Curated;200197

Pathway

oxidative stress induced gene expression via nrf2;PID BioCarta;100238

Pathway

Regulation of nuclear SMAD2/3 signaling;PID Curated;200002

Pathway

pdgf signaling pathway;PID BioCarta;100077

Pathway

ATF-2 transcription factor network;PID Curated;200116

Pathway

IL12-mediated signaling events;PID Curated;200034

Pathway

Insulin/IGF pathway-mitogen activated protein kinase kinase/MAP kinase cascade;PANTHER;P00032

Pathway

PDGFR-alpha signaling pathway;PID Curated;200140

Pathway

FOXM1 transcription factor network;PID Curated;200120

Pathway

Glucocorticoid receptor regulatory network;PID Curated;200077

Pathway

BCR signaling pathway;PID Curated;200005

Pathway

calcium signaling by hbx of hepatitis b virus;PID BioCarta;100150

Pathway

Calcium signaling in the CD4+ TCR pathway;PID Curated;200159

Pathway

il 3 signaling pathway;PID BioCarta;100128

Pathway

Regulation of Telomerase;PID Curated;200072

Pathway

mapkinase signaling pathway;PID BioCarta;100113

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

Osteopontin-mediated events;PID Curated;200042

Pathway

T cell activation;PANTHER;P00053

Pathway

Nongenotropic Androgen signaling;PID Curated;200145

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

IL2-mediated signaling events;PID Curated;200082

Pathway

Calcineurin-regulated NFAT-dependent transcription in lymphocytes;PID Curated;200039

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

inhibition of cellular proliferation by gleevec;PID BioCarta;100154

Pathway

Activation of the AP-1 family of transcription factors;PID Reactome;500458

Pathway

fc epsilon receptor i signaling in mast cells;PID BioCarta;100165

Pathway

tsp-1 induced apoptosis in microvascular endothelial cell;PID BioCarta;100010

Pathway

signal transduction through il1r;PID BioCarta;100132

Pathway

mets affect on macrophage differentiation;PID BioCarta;100169

Pathway

Endothelins;PID Curated;200004

Pathway

B cell activation;PANTHER;P00010

Pathway

Presenilin action in Notch and Wnt signaling;PID Curated;200052

Pathway

Downstream signaling in naive CD8+ T cells;PID Curated;200184

Pathway

keratinocyte differentiation;PID BioCarta;100119

Pathway

toll-like receptor pathway;PID BioCarta;100013

Pathway

Trk receptor signaling mediated by the MAPK pathway;PID Curated;200182

Pathway

Leishmaniasis;KEGG PATHWAY;hsa05140

Pathway

AP-1 transcription factor network;PID Curated;200118

Pathway

ErbB1 downstream signaling;PID Curated;200113

Pathway

angiotensin ii mediated activation of jnk pathway via pyk2 dependent signaling;PID BioCarta;100236

Pathway

bcr signaling pathway;PID BioCarta;100227

Pathway

Fc-epsilon receptor I signaling in mast cells;PID Curated;200003

Pathway

t cell receptor signaling pathway;PID BioCarta;100022

Pathway

Huntington disease;PANTHER;P00029

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

bone remodeling;PID BioCarta;100052

Pathway

Chagas disease;KEGG PATHWAY;hsa05142

Pathway

nerve growth factor pathway (ngf);PID BioCarta;100096

Pathway

S1P2 pathway;PID Curated;200181

Pathway

Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620

Pathway

FOXA1 transcription factor network;PID Curated;200194

Pathway

tpo signaling pathway;PID BioCarta;100012

Pathway

RhoA signaling pathway;PID Curated;200007

Pathway

repression of pain sensation by the transcriptional regulator dream;PID BioCarta;100186

Pathway

cadmium induces dna synthesis and proliferation in macrophages;PID BioCarta;100209

Pathway

IL6-mediated signaling events;PID Curated;200124

Pathway

Interleukin signaling pathway;PANTHER;P00036

Pathway

role of egf receptor transactivation by gpcrs in cardiac hypertrophy;PID BioCarta;100221

Pathway

GMCSF-mediated signaling events;PID Curated;200015

Pathway

FGF signaling pathway;PID Curated;200189

External Links

Links to cell senescence gene database

2353

Links to epithelial mesenchymal transition gene database

2353

Links to ovarian cancer gene database

2353

Links to endometrial cancer gene database

2353

Links to iHOP

2353

Sequence Information

Nucleotide Sequence

>2353 : length: 2158
ATTCATAAAACGCTTGTTATAAAAGCAGTGGCTGCGGCGCCTCGTACTCCAACCGCATCT
GCAGCGAGCATCTGAGAAGCCAAGACTGAGCCGGCGGCCGCGGCGCAGCGAACGAGCAGT
GACCGTGCTCCTACCCAGCTCTGCTCCACAGCGCCCACCTGTCTCCGCCCCTCGGCCCCT
CGCCCGGCTTTGCCTAACCGCCACGATGATGTTCTCGGGCTTCAACGCAGACTACGAGGC
GTCATCCTCCCGCTGCAGCAGCGCGTCCCCGGCCGGGGATAGCCTCTCTTACTACCACTC
ACCCGCAGACTCCTTCTCCAGCATGGGCTCGCCTGTCAACGCGCAGGACTTCTGCACGGA
CCTGGCCGTCTCCAGTGCCAACTTCATTCCCACGGTCACTGCCATCTCGACCAGTCCGGA
CCTGCAGTGGCTGGTGCAGCCCGCCCTCGTCTCCTCCGTGGCCCCATCGCAGACCAGAGC
CCCTCACCCTTTCGGAGTCCCCGCCCCCTCCGCTGGGGCTTACTCCAGGGCTGGCGTTGT
GAAGACCATGACAGGAGGCCGAGCGCAGAGCATTGGCAGGAGGGGCAAGGTGGAACAGTT
ATCTCCAGAAGAAGAAGAGAAAAGGAGAATCCGAAGGGAAAGGAATAAGATGGCTGCAGC
CAAATGCCGCAACCGGAGGAGGGAGCTGACTGATACACTCCAAGCGGAGACAGACCAACT
AGAAGATGAGAAGTCTGCTTTGCAGACCGAGATTGCCAACCTGCTGAAGGAGAAGGAAAA
ACTAGAGTTCATCCTGGCAGCTCACCGACCTGCCTGCAAGATCCCTGATGACCTGGGCTT
CCCAGAAGAGATGTCTGTGGCTTCCCTTGATCTGACTGGGGGCCTGCCAGAGGTTGCCAC
CCCGGAGTCTGAGGAGGCCTTCACCCTGCCTCTCCTCAATGACCCTGAGCCCAAGCCCTC
AGTGGAACCTGTCAAGAGCATCAGCAGCATGGAGCTGAAGACCGAGCCCTTTGATGACTT
CCTGTTCCCAGCATCATCCAGGCCCAGTGGCTCTGAGACAGCCCGCTCCGTGCCAGACAT
GGACCTATCTGGGTCCTTCTATGCAGCAGACTGGGAGCCTCTGCACAGTGGCTCCCTGGG
GATGGGGCCCATGGCCACAGAGCTGGAGCCCCTGTGCACTCCGGTGGTCACCTGTACTCC
CAGCTGCACTGCTTACACGTCTTCCTTCGTCTTCACCTACCCCGAGGCTGACTCCTTCCC
CAGCTGTGCAGCTGCCCACCGCAAGGGCAGCAGCAGCAATGAGCCTTCCTCTGACTCGCT
CAGCTCACCCACGCTGCTGGCCCTGTGAGGGGGCAGGGAAGGGGAGGCAGCCGGCACCCA
CAAGTGCCACTGCCCGAGCTGGTGCATTACAGAGAGGAGAAACACATCTTCCCTAGAGGG
TTCCTGTAGACCTAGGGAGGACCTTATCTGTGCGTGAAACACACCAGGCTGTGGGCCTCA
AGGACTTGAAAGCATCCATGTGTGGACTCAAGTCCTTACCTCTTCCGGAGATGTAGCAAA
ACGCATGGAGTGTGTATTGTTCCCAGTGACACTTCAGAGAGCTGGTAGTTAGTAGCATGT
TGAGCCAGGCCTGGGTCTGTGTCTCTTTTCTCTTTCTCCTTAGTCTTCTCATAGCATTAA
CTAATCTATTGGGTTCATTATTGGAATTAACCTGGTGCTGGATATTTTCAAATTGTATCT
AGTGCAGCTGATTTTAACAATAACTACTGTGTTCCTGGCAATAGTGTGTTCTGATTAGAA
ATGACCAATATTATACTAAGAAAAGATACGACTTTATTTTCTGGTAGATAGAAATAAATA
GCTATATCCATGTACTGTAGTTTTTCTTCAACATCAATGTTCATTGTAATGTTACTGATC
ATGCATTGTTGAGGTGGTCTGAATGTTCTGACATTAACAGTTTTCCATGAAAACGTTTTA
TTGTGTTTTTAATTTATTTATTAAGATGGATTCTCAGATATTTATATTTTTATTTTATTT
TTTTCTACCTTGAGGTCTTTTGACATGTGGAAAGTGAATTTGAATGAAAAATTTAAGCAT
TGTTTGCTTATTGTTCCAAGACATTGTCAATAAAAGCATTTAAGTTGAATGCGACCAA

Protein Sequence

>2353 : length: 380
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF
IPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFT
LPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL