ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

23523

Name

CABIN1

Synonym

CAIN|PPP3IN;calcineurin binding protein 1;CABIN1;calcineurin binding protein 1

Definition

calcineurin binding protein cabin 1|calcineurin inhibitor|calcineurin-binding protein cabin-1

Position

22q11.23

Gene Type

protein-coding

Pathways and Diseases

Pathway

Role of Calcineurin-dependent NFAT signaling in lymphocytes;PID Curated;200076

Pathway

Calcium signaling in the CD4+ TCR pathway;PID Curated;200159

Pathway

control of skeletal myogenesis by hdac and calcium/calmodulin-dependent kinase (camk);PID BioCarta;100148

Pathway

role of mef2d in t-cell apoptosis;PID BioCarta;100109

External Links

Links to cell senescence gene database

23523

Links to epithelial mesenchymal transition gene database

23523

Links to ovarian cancer gene database

23523

Links to endometrial cancer gene database

23523

Links to iHOP

23523

Sequence Information

Nucleotide Sequence

>23523 : length: 7528
GAGTTCCTGGAAGGCTGGTTTGAAGGCGGTGCCGGGGTGGGGGTGAGGCTCAGCAGAGCC
CGGGGCACAGGCCGGAGGGGCTGCAGGCGCGAGGCTGGGTTACGTGAGGAAGCTGGGGGT
TTCGCGGGCAGCTTTAGAGCCCCAGTCAGGGAAACCGAGGCCGGGCTTCCTGGCTGCCTC
GCGAGCCTCTTCATGGCTCTCGCCGCCGCCCTGAGGTGCCTAGAATGGGTTCCGGCCTCC
GGGGAGGTTCCCAGTAACCGCAGGAGCCACCATTGATTTGGCGTCTGCTGGGTGCAAAGC
CCAGCGCGCTAACCCTTTACTCGCGACCTTTCGCTTCACCTTCACAGCAGCCCTGCGAGG
AGAGTTGTGGACTGGGGCAACCTTTGCCAGTGATGAGAAGTGATGCTCGTGGCAGTGCTG
AATCTCTCTGAATATGATTCGAATTGCAGCCTTAAATGCCAGCTCCACCATTGAGGATGA
TCATGAAGGAAGCTTTAAAAGTCACAAAACCCAGACAAAGGAGGCTCAGGAAGCAGAGGC
TTTTGCATTGTACCACAAGGCCCTTGATCTGCAGAAACATGACCGGTTTGAGGAGTCTGC
CAAAGCCTACCATGAGCTCTTGGAGGCGAGCCTGCTGCGGGAGGCAGTTTCATCCGGTGA
TGAGAAAGAGGGGTTGAAACACCCTGGGCTGATACTGAAATATTCCACTTATAAGAACTT
GGCCCAGCTGGCAGCCCAGCGGGAGGATCTGGAGACAGCCATGGAGTTCTACTTAGAGGC
AGTGATGCTGGACTCCACAGATGTCAACCTCTGGTATAAGATTGGACATGTGGCCCTGAG
GCTCATCCGGATCCCCCTGGCTCGCCATGCTTTTGAGGAAGGGCTGCGGTGCAATCCTGA
CCACTGGCCCTGTTTGGATAACCTAATCACTGTCCTGTACACCCTCAGTGATTACACAAC
ATGTCTGTACTTCATCTGCAAAGCTTTGGAGAAGGATTGCCGGTACAGCAAAGGGCTGGT
CCTCAAGGAGAAGATTTTTGAGGAGCAGCCTTGTCTCCGGAAGGACTCTCTCAGAATGTT
CCTCAAATGTGACATGTCGATTCACGATGTTTCGGTGAGTGCAGCTGAGACACAGGCGAT
TGTAGATGAGGCCTTGGGGCTGCGAAAAAAGAGGCAAGCGCTGATTGTGCGGGAGAAGGA
GCCGGACCTGAAACTTGTGCAGCCCATTCCTTTCTTCACCTGGAAGTGCCTCGGAGAGAG
CTTGCTGGCCATGTACAATCATCTCACCACCTGTGAGCCCCCACGTCCCAGCCTTGGCAA
AAGGATTGATTTGTCGGACTACCAGGACCCCAGCCAGCCTCTTGAGTCCTCCATGGTGGT
GACGCCAGTTAACGTGATCCAGCCAAGCACTGTCAGCACCAACCCAGCTGTGGCTGTCGC
CGAGCCTGTGGTCTCCTACACCTCTGTGGCTACAACCAGCTTCCCACTGCACAGTCCTGG
TCTGTTGGAGACAGGCGCTCCTGTGGGTGATATTTCTGGGGGAGATAAATCCAAGAAAGG
GGTAAAACGGAAGAAGATTTCAGAAGAGAGTGGAGAAACAGCAAAGCGGCGGTCTGCCCG
TGTCCGAAACACCAAGTGCAAAAAAGAAGAGAAAGTAGACTTCCAGGAGCTTCTGATGAA
GTTCTTGCCGTCCAGGTTAAGAAAGCTGGACCCTGAGGAGGAAGATGATTCCTTTAATAA
CTATGAAGTCCAGTCAGAAGCCAAACTGGAAAGCTTCCCAAGCATTGGGCCTCAAAGGCT
GTCATTTGACTCAGCCACATTCATGGAATCTGAAAAGCAGGACGTGCATGAGTTCCTGCT
GGAGAACCTAACCAACGGGGGCATCCTGGAGCTGATGATGCGCTACCTGAAAGCCATGGG
CCACAAGTTCTTGGTAAGGTGGCCTCCAGGCTTGGCGGAGGTCGTGCTCAGCGTCTACCA
CAGCTGGAGGAGGCACAGCACCAGCCTGCCCAACCCGCTGCTGAGGGACTGCAGCAACAA
GCACATCAAGGACATGATGCTGATGTCTCTCTCCTGCATGGAACTCCAGCTGGACCAGTG
GCTGCTGACCAAAGGCAGAAGCTCTGCAGTGTCTCCTCGGAACTGCCCTGCTGGTATGGT
GAATGGCAGATTTGGACCTGACTTCCCAGGGACCCACTGCCTGGGTGACCTCCTACAGCT
GTCATTTGCCTCGTCCCAGCGCGACCTGTTCGAGGATGGTTGGCTGGAGTTTGTGGTCCG
TGTTTACTGGCTGAAGGCTCGCTTCCTGGCGCTGCAGGGAGACATGGAGCAGGCCCTGGA
GAACTATGACATCTGCACAGAAATGCTCCAGAGTTCCACCGCCATCCAGGTGGAGGCAGG
GGCTGAACGAAGAGACATTGTCATCCGGCTGCCCAACCTCCATAATGACTCTGTGGTTTC
CCTGGAGGAGATTGATAAGAACCTGAAGTCGCTGGAGCGGTGCCAGTCCCTGGAGGAGAT
TCAGCGGCTGTATGAAGCAGGCGACTACAAGGCTGTTGTGCATCTGCTCCGCCCCACTTT
GTGCACCAGTGGGTTTGACCGGGCCAAACACCTGGAGTTTATGACTTCCATTCCTGAGAG
GCCAGCCCAGCTGCTTCTTCTGCAGGACTCCTTGCTCCGGCTGAAGGACTATCGGCAGTG
TTTTGAGTGTTCCGATGTGGCTCTGAACGAGGCTGTCCAGCAGATGGTGAACTCAGGTGA
GGCTGCCGCCAAGGAGGAGTGGGTGGCCACAGTGACCCAACTGCTGATGGGCATCGAGCA
GGCCCTCTCTGCGGACAGCAGTGGTAGCATCCTGAAGGTATCATCCTCCACCACTGGCCT
TGTGCGGCTCACCAACAACCTCATCCAGGTCATTGACTGCAGCATGGCTGTGCAGGAGGA
GGCCAAGGAGCCCCACGTCTCTTCAGTGCTACCCTGGATCATTCTACACCGGATCATCTG
GCAGGAGGAAGACACCTTCCATTCTCTGTGCCACCAGCAGCAGCTCCAAAACCCAGCGGA
GGAAGGGATGTCAGAGACGCCCATGCTCCCATCCTCCCTCATGCTGCTGAACACAGCCCA
CGAGTATTTGGGCAGAAGGTCCTGGTGCTGCAATTCAGATGGGGCTCTGCTGCGATTCTA
TGTGCGAGTACTCCAGAAGGAACTGGCTGCATCCACCTCTGAAGACACGCACCCTTACAA
GGAGGAGCTGGAGACAGCCTTGGAGCAGTGCTTCTACTGCCTGTACAGCTTCCCCAGCAA
GAAGAGTAAGGCCAGGTACCTGGAGGAACACTCGGCCCAGCAGGTGGATCTTATATGGGA
GGATGCACTGTTCATGTTTGAGTATTTTAAGCCCAAGACCCTTCCTGAATTTGACAGCTA
TAAGACCAGCACCGTGTCTGCTGACTTGGCCAACCTACTGAAGAGAATTGCCACCATTGT
GCCTCGCACAGAGAGGCCAGCCCTTAGCCTGGACAAAGTCTCTGCCTACATTGAGGGAAC
TTCAACTGAGGTACCCTGCCTCCCAGAGGGGGCTGACCCCTCCCCTCCAGTGGTGAACGA
GCTTTACTACCTCCTGGCTGATTATCATTTCAAAAACAAGGAGCAGTCCAAGGCCATCAA
GTTCTACATGCATGACATCTGCATCTGCCCCAATAGGTTTGATTCCTGGGCAGGCATGGC
TCTGGCCCGGGCCAGCCGCATTCAGGACAAGCTGAACTCCAATGAGCTGAAGAGTGATGG
GCCCATTTGGAAGCATGCCACGCCCGTCTTGAACTGCTTCCGTCGGGCCCTGGAGATTGA
CAGCTCCAACTTGTCCCTATGGATTGAGTATGGCACCATGTCCTATGCCTTGCACTCATT
CGCCTCACGTCAATTGAAGCAGTGGAGAGGCGAGCTGCCCCCTGAGCTCGTGCAGCAGAT
GGAGGGCCGGCGCGACAGCATGCTAGAGACAGCCAAGCACTGTTTCACATCAGCAGCCCG
CTGCGAGGGTGATGGTGACGAGGAGGAGTGGCTCATCCACTACATGCTGGGCAAGGTGGC
TGAGAAGCAGCAGCAGCCACCCACCGTTTACTTGCTGCACTACAGGCAGGCTGGCCACTA
CCTGCACGAGGAGGCTGCCCGCTACCCCAAGAAGATCCACTACCACAACCCACCTGAGCT
GGCCATGGAGGCCCTGGAGGTGTACTTTCGGCTCCATGCTTCCATCCTGAAGCTCCTGGG
GAAGCCCGATTCTGGGGTTGGTGCAGAGGTCCTGGTCAACTTTATGAAGGAGGCTGCAGA
AGGACCCTTTGCCAGGGGCGAGGAGAAGAACACACCCAAAGCTTCAGAAAAGGAGAAGGC
CTGCCTGGTGGACGAGGACTCCCACTCTTCAGCTGGGACACTGCCGGGCCCCGGAGCCTC
CCTCCCCTCCTCCTCTGGCCCAGGTCTGACATCCCCACCTTACACAGCCACTCCGATTGA
CCACGATTACGTCAAATGTAAAAAACCCCACCAGCAGGCAACGCCGGACGACCGAAGCCA
GGACAGCACAGCCGTAGCACTCTCAGACTCTAGCTCAACGCAGGACTTCTTTAATGAGCC
CACCAGCTTACTGGAAGGCTCCAGGAAATCCTACACAGAGAAGAGGCTGCCCATTCTCAG
TTCCCAAGCAGGAGCGACGGGTAAAGATCTTCAGGGGGCCACAGAAGAAAGAGGAAAAAA
CGAGGAGTCATTGGAGAGTACAGAAGGCTTCCGGGCTGCAGAGCAAGGTGTCCAGAAGCC
TGCTGCAGAAACCCCAGCCTCTGCTTGCATCCCTGGCAAGCCCTCAGCATCCACACCCAC
CCTGTGGGATGGGAAGAAGAGAGGGGACCTCCCAGGGGAGCCAGTGGCCTTCCCCCAGGG
GCTGCCGGCTGGTGCTGAGGAGCAGCGGCAGTTTCTCACAGAGCAGTGCATCGCCTCCTT
CCGCCTGTGCCTGAGCCGCTTCCCCCAGCACTATAAGAGTCTCTACCGTCTGGCCTTCCT
CTACACCTACAGCAAGACCCACCGGAACCTCCAGTGGGCCCGCGACGTGTTGCTAGGCAG
CAGTATCCCGTGGCAACAACTGCAGCACATGCCGGCACAGGGGCTCTTCTGCGAGAGGAA
CAAGACCAATTTCTTCAACGGCATCTGGCGGATCCCCGTGGACGAGATTGACCGGCCGGG
CAGCTTTGCCTGGCACATGAACCGCTCCATCGTGCTGCTGCTCAAGGTGCTGGCCCAGCT
GCGGGACCACAGCACCCTGCTGAAGGTGTCCTCCATGCTTCAGCGGACCCCAGACCAGGG
CAAGAAGTATCTGCGAGATGCTGACCGCCAGGTCCTGGCGCAGCGGGCCTTCATCCTCAC
TGTGAAGGTGCTCGAAGACACGCTGAGCGAGCTCGCAGAGGGGTCAGAACGCCCAGGGCC
CAAGGTCTGTGGCCTCCCCGGAGCCAGGATGACCACCGATGTCTCACACAAGGCCAGTCC
TGAGGATGGCCAGGAGGGCCTCCCCCAGCCGAAGAAGCCCCCTCTGGCTGATGGCTCAGG
GCCAGGGCCCGAGCCAGGAGGCAAAGTGGGCCTCCTCAACCACCGGCCTGTGGCCATGGA
TGCAGGAGACAGTGCAGACCAAAGCGGGGAGCGGAAGGATAAAGAGAGCCCACGGGCAGG
GCCCACTGAGCCCATGGACACGAGTGAGGCCACTGTTTGCCACTCAGACTTGGAGCGGAC
ACCACCCCTGCTGCCAGGTCGCCCCGCAAGGGACCGGGGCCCCGAGAGCCGGCCCACTGA
GCTGTCCCTGGAGGAGCTGAGCATCAGTGCCCGGCAGCAGCCCACCCCGCTCACCCCAGC
CCAGCCAGCCCCCGCCCCCGCCCCCGCCACCACCACAGGGACCAGGGCAGGGGGCCACCC
GGAGGAGCCGCTCTCCCGGCTCAGCCGCAAGAGGAAGCTCCTGGAGGACACAGAGTCAGG
CAAGACACTTCTGTTGGATGCCTACCGTGTGTGGCAGCAGGGCCAGAAGGGTGTGGCCTA
TGACCTGGGCCGTGTGGAGAGGATCATGTCGGAGACCTACATGCTCATCAAGCAGGTGGA
TGAGGAGGCTGCGCTGGAGCAGGCTGTGAAGTTCTGCCAGGTCCATCTTGGGGCTGCCGC
CCAGAGACAGGCCTCGGGGGACACCCCCACCACTCCAAAGCACCCCAAAGACAGCCGAGA
GAACTTCTTTCCTGTGACAGTGGTGCCCACAGCCCCTGACCCTGTGCCAGCTGACTCTGT
CCAGCGGCCCAGTGATGCTCACACCAAGCCTCGCCCTGCACTAGCTGCCGCCACAACTAT
TATCACCTGCCCTCCGTCAGCATCAGCTTCCACCCTGGACCAGTCCAAGGACCCTGGGCC
TCCCCGGCCACACAGGCCTGAAGCTACCCCCAGCATGGCCTCTCTGGGCCCAGAGGGAGA
AGAGCTGGCGAGAGTGGCAGAGGGCACCAGCTTCCCGCCTCAGGAGCCACGGCACAGTCC
GCAGGTGAAGATGGCCCCCACAAGTTCCCCGGCAGAGCCACACTGCTGGCCGGCAGAGGC
TGCCCTGGGCACAGGCGCTGAGCCCACCTGCAGCCAGGAGGGGAAACTGAGGCCTGAGCC
GAGAAGGGATGGGGAGGCTCAGGAGGCTGCGAGTGAGACTCAGCCCCTGAGCTCTCCCCC
AACAGCTGCCAGCTCCAAGGCCCCCAGCAGTGGGAGTGCCCAGCCACCAGAGGGTCACCC
AGGCAAGCCTGAGCCCAGCCGGGCTAAGTCCCGCCCCCTGCCCAACATGCCAAAGCTGGT
CATCCCCTCCGCCGCCACCAAGTTCCCCCCTGAGATCACCGTCACGCCACCCACCCCAAC
CCTGCTCTCCCCCAAAGGCAGCATCTCGGAGGAGACCAAGCAGAAGCTGAAGTCAGCCAT
CCTTTCTGCCCAGTCTGCTGCCAACGTGAGGAAGGAGAGCCTATGCCAGCCAGCCCTGGA
GGTCCTGGAGACATCCAGCCAGGAGTCCTCGCTGGAGAGCGAGACAGACGAGGACGACGA
CTACATGGACATTTGAGGGGCCACTGCAGCCCCACCGCCACGCCCCAGGGGACCAGCCAG
GCCTGGAATGCCCCCTGGGCAGGACCCTGGGCAGGACCAGAGGCCCACATGGATGCCACT
CCCCACACAGCCCCCAGGCCTGCCCAGCCCACCTCCTCATGGCATCCTCCCTGTACCCAG
GTCAGGCTGTCCACACCACATGGGAGCCCAGAGGAGGAGGGGCCCGCCTTAGCCATGTGA
AGGTGGATTGGTCGCCATCTGCACGCCAGGCGGCATCCTTTTCTATGAAGTGTTGACTTT
GTAAATCTGCCCACACCCAGCTGGCCATATCCACCCCTCGACGCCGGGATGAGCCGGCTC
TGCCTGTGTCACAGTGGAGGGGTCCTTTAGGGCCAGGCTCACCCCTCACCCTTTTTTTGG
TTGCTTTTCTAATAAAGATGGAACAGTT

Protein Sequence

>23523 : length: 2255
MIRIAALNASSTIEDDHEGSFKSHKTQTKEAQEAEAFALYHKALDLQKHDRFEESAKAYH
ELLEASLLREAVSSGDEKEGLKHPGLILKYSTYKNLAQLAAQREDLETAMEFYLEAVMLD
STDVNLWYKIGHVALRLIRIPLARHAFEEGLRCNPDHWPCLDNLITVLYTLSDYTTCLYF
ICKALEKDCRYSKGLVLKEKIFEEQPCLRKDSLRMFLKCDMSIHDVSVSAAETQAIVDEA
LGLRKKRQALIVREKEPDLKLVQPIPFFTWKCLGESLLAMYNHLTTCEPPRPSLGKRIDL
SDYQDPSQPLESSMVVTPVNVIQPSTVSTNPAVAVAEPVVSYTSVATTSFPLHSPGLLET
GAPVGDISGGDKSKKGVKRKKISEESGETAKRRSARVRNTKCKKEEKVDFQELLMKFLPS
RLRKLDPEEEDDSFNNYEVQSEAKLESFPSIGPQRLSFDSATFMESEKQDVHEFLLENLT
NGGILELMMRYLKAMGHKFLVRWPPGLAEVVLSVYHSWRRHSTSLPNPLLRDCSNKHIKD
MMLMSLSCMELQLDQWLLTKGRSSAVSPRNCPAGMVNGRFGPDFPGTHCLGDLLQLSFAS
SQRDLFEDGWLEFVVRVYWLKARFLALQGDMEQALENYDICTEMLQSSTAIQVEAGAERR
DIVIRLPNLHNDSVVSLEEIDKNLKSLERCQSLEEIQRLYEAGDYKAVVHLLRPTLCTSG
FDRAKHLEFMTSIPERPAQLLLLQDSLLRLKDYRQCFECSDVALNEAVQQMVNSGEAAAK
EEWVATVTQLLMGIEQALSADSSGSILKVSSSTTGLVRLTNNLIQVIDCSMAVQEEAKEP
HVSSVLPWIILHRIIWQEEDTFHSLCHQQQLQNPAEEGMSETPMLPSSLMLLNTAHEYLG
RRSWCCNSDGALLRFYVRVLQKELAASTSEDTHPYKEELETALEQCFYCLYSFPSKKSKA
RYLEEHSAQQVDLIWEDALFMFEYFKPKTLPEFDSYKTSTVSADLANLLKRIATIVPRTE
RPALSLDKVSAYIEGTSTEVPCLPEGADPSPPVVNELYYLLADYHFKNKEQSKAIKFYMH
DICICPNRFDSWAGMALARASRIQDKLNSNELKSDGPIWKHATPVLNCFRRALEIDSSNL
SLWIEYGTMSYALHSFASRQLKQWRGELPPELVQQMEGRRDSMLETAKHCFTSAARCEGD
GDEEEWLIHYMLGKVAEKQQQPPTVYLLHYRQAGHYLHEEAARYPKKIHYHNPPELAMEA
LEVYFRLHASILKLLGKPDSGVGAEVLVNFMKEAAEGPFARGEEKNTPKASEKEKACLVD
EDSHSSAGTLPGPGASLPSSSGPGLTSPPYTATPIDHDYVKCKKPHQQATPDGTVPVLPT
ASPGRHINHGGVLGRLILSLRFDRSQDSTAVALSDSSSTQDFFNEPTSLLEGSRKSYTEK
RLPILSSQAGATGKDLQGATEERGKNEESLESTEGFRAAEQGVQKPAAETPASACIPGKP
SASTPTLWDGKKRGDLPGEPVAFPQGLPAGAEEQRQFLTEQCIASFRLCLSRFPQHYKSL
YRLAFLYTYSKTHRNLQWARDVLLGSSIPWQQLQHMPAQGLFCERNKTNFFNGIWRIPVD
EIDRPGSFAWHMNRSIVLLLKVLAQLRDHSTLLKVSSMLQRTPDQGKKYLRDADRQVLAQ
RAFILTVKVLEDTLSELAEGSERPGPKVCGLPGARMTTDVSHKASPEDGQEGLPQPKKPP
LADGSGPGPEPGGKVGLLNHRPVAMDAGDSADQSGERKDKESPRAGPTEPMDTSEATVCH
SDLERTPPLLPGRPARDRGPESRPTELSLEELSISARQQPTPLTPAQPAPAPAPATTTGT
RAGGHPEEPLSRLSRKRKLLEDTESGKTLLLDAYRVWQQGQKGVAYDLGRVERIMSETYM
LIKQHLPVKVDEEAALEQAVKFCQVHLGAAAQRQASGDTPTTPKHPKDSRENFFPVTVVP
TAPDPVPADSVQRPSDAHTKPRPALAAATTIITCPPSASASTLDQSKDPGPPRPHRPEAT
PSMASLGPEGEELARVAEGTSFPPQEPRHSPQVKMAPTSSPAEPHCWPAEAALGTGAEPT
CSQEGKLRPEPRRDGEAQEAASETQPLSSPPTAASSKAPSSGSAQPPEGHPGKPEPSRAK
SRPLPNMPKLVIPSAATKFPPEITVTPPTPTLLSPKGSISEETKQKLKSAILSAQSAANV
RKESLCQPALEVLETSSQESSLESETDEDDDYMDI