ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

23520

Name

ANP32C

Synonym

PP32R1;acidic (leucine-rich) nuclear phosphoprotein 32 family, member C;ANP32C;acidic (leucine-rich) nuclear phosphoprotein 32 family, member C

Definition

acidic leucine-rich nuclear phosphoprotein 32 family member C|phosphoprotein 32-related protein 1|pp32 related 1|tumorigenic protein pp32r1

Position

4q32.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

23520

Links to epithelial mesenchymal transition gene database

23520

Links to ovarian cancer gene database

23520

Links to endometrial cancer gene database

23520

Links to iHOP

23520

Sequence Information

Nucleotide Sequence

>23520 : length: 705
ATGGAGATGGGCAGACGGATTCATTCAGAGCTGCGGAACAGGGCGCCCTCTGATGTGAAA
GAACTTGCCCTGGACAACAGTCGGTCGAATGAAGGCAAACTCGAAGCCCTCACAGATGAA
TTTGAAGAACTGGAATTCTTAAGTAAAATCAACGGAGGCCTCACCTCAATCTCAGACTTA
CCAAAGTTAAAGTTGAGAAAGCTTGAACTAAGAGTCTCAGGGGGCCTGGAAGTATTGGCA
GAAAAGTGTCCAAACCTCACGCATCTATATTTAAGTGGCAACAAAATTAAAGACCTCAGC
ACAATAGAGCCACTGAAACAGTTAGAAAACCTCAAGAGCTTAGACCTTTTCAATTGCGAG
GTAACCAACCTGAACGACTACGGAGAAAACGTGTTCAAGCTTCTCCTGCAACTCACATAT
CTCGACAGCTGTTACTGGGACCACAAGGAGGCCCCTTACTCAGATATTGAGGACCACGTG
GAGGGCCTGGATGACGAGGAGGAGGGTGAGCATGAGGAGGAGTATGATGAAGATGCTCAG
GTAGTGGAAGATGAGGAGGGCGAGGAGGAGGAGGAGGAAGGTGAAGAGGAGGACGTGAGT
GGAGGGGACGAGGAGGATGAAGAAGGTTATAACGATGGAGAGGTAGATGGCGAGGAAGAT
GAAGAAGAGCTTGGTGAAGAAGAAAGGGGTCAGAAGCGAAAATGA

Protein Sequence

>23520 : length: 234
MEMGRRIHSELRNRAPSDVKELALDNSRSNEGKLEALTDEFEELEFLSKINGGLTSISDL
PKLKLRKLELRVSGGLEVLAEKCPNLTHLYLSGNKIKDLSTIEPLKQLENLKSLDLFNCE
VTNLNDYGENVFKLLLQLTYLDSCYWDHKEAPYSDIEDHVEGLDDEEEGEHEEEYDEDAQ
VVEDEEGEEEEEEGEEEDVSGGDEEDEEGYNDGEVDGEEDEEELGEEERGQKRK