ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

23519

Name

ANP32D

Synonym

PP32R2;acidic (leucine-rich) nuclear phosphoprotein 32 family, member D;ANP32D;acidic (leucine-rich) nuclear phosphoprotein 32 family, member D

Definition

acidic leucine-rich nuclear phosphoprotein 32 family member D|acidic nuclear phosphoprotein 32D|phosphoprotein 32-related protein 2|pp32 related 2|tumorigenic protein pp32r2

Position

12q13.11

Gene Type

protein-coding

External Links

Links to cell senescence gene database

23519

Links to epithelial mesenchymal transition gene database

23519

Links to ovarian cancer gene database

23519

Links to endometrial cancer gene database

23519

Links to iHOP

23519

Sequence Information

Nucleotide Sequence

>23519 : length: 396
ATGGAGATGGGCAAATGGATTCATTTAGAGCTGCGGAACAGGACGCCCTCCGATGTGAAA
GAACTTTTCCTGGACAACAGTCAGTCAAATGAAGGCAAATTGGAAGGCCTCACAGATGAA
TTTGAAGAACTGGAATTATTAAATACAATCAACATAGGCCTCACCTCAATTGCAAACTTG
CCAAAGTTAAACAAACTTAAGAAGCTTGAACTAAGCAGTAACAGAGCCTCAGTGGGCCTA
GAAGTATTGGCAGAAAAGTGTCCAAACCTCATACATCTAAATTTAAGTGGCAACAAAATT
AAAGACCTCAGCACAATAGAGCCCCTGAAAAAGTTAGAAAACCTCGAGAGCTTAGACCTT
TTCACTTGCGAGGTAACCAACCTGAACAACTACTGA

Protein Sequence

>23519 : length: 131
MEMGKWIHLELRNRTPSDVKELFLDNSQSNEGKLEGLTDEFEELELLNTINIGLTSIANL
PKLNKLKKLELSSNRASVGLEVLAEKCPNLIHLNLSGNKIKDLSTIEPLKKLENLESLDL
FTCEVTNLNNY