ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

23512

Name

SUZ12

Synonym

CHET9|JJAZ1;SUZ12 polycomb repressive complex 2 subunit;SUZ12;SUZ12 polycomb repressive complex 2 subunit

Definition

chET 9 protein|chromatin precipitated E2F target 9 protein|joined to JAZF1 protein|polycomb protein SUZ12|suppressor of zeste 12 homolog|suppressor of zeste 12 protein homolog

Position

17q11.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

23512

Links to epithelial mesenchymal transition gene database

23512

Links to ovarian cancer gene database

23512

Links to endometrial cancer gene database

23512

Links to iHOP

23512

Sequence Information

Nucleotide Sequence

>23512 : length: 4477
GGTGAGCGGCCTCCGAAGCGGAGCGGGGCTCTGAGGAGACACTTTTTTTTTCCTCCCTCC
TTCCCTCCTCTCCTCCTCCCTTCCCTTCCCCTCTCCTCCCCTCTCTCCTCCTTCCCCCCT
CGGTCCGCCGGAGCCTGCTGGGGCGAGCGGTTGGTATTGCAGGCGCTTGCTCTCCGGGGC
CGCCCGGCGGGTAGCTGGCGGGGGGAGGAGGCAGGAACCGCGATGGCGCCTCAGAAGCAC
GGCGGTGGGGGAGGGGGCGGCTCGGGGCCCAGCGCGGGGTCCGGGGGAGGCGGCTTCGGG
GGTTCGGCGGCGGTGGCGGCGGCGACGGCTTCGGGCGGCAAATCCGGCGGCGGGAGCTGT
GGAGGGGGTGGCAGTTACTCGGCCTCCTCCTCCTCCTCCGCGGCGGCAGCGGCGGGGGCT
GCGGTGTTACCGGTGAAGAAGCCGAAAATGGAGCACGTCCAGGCTGACCACGAGCTTTTC
CTCCAGGCCTTTGAGAAGCCAACACAGATCTATAGATTTCTTCGAACTCGGAATCTCATA
GCACCAATATTTTTGCACAGAACTCTTACTTACATGTCTCATCGAAACTCCAGAACAAAC
ATCAAAAGGAAAACATTTAAAGTTGATGATATGTTATCAAAAGTAGAGAAAATGAAAGGA
GAGCAAGAATCTCATAGCTTGTCAGCTCATTTGCAGCTTACGTTTACTGGTTTCTTCCAC
AAAAATGATAAGCCATCACCAAACTCAGAAAATGAACAAAATTCTGTTACCCTGGAAGTC
CTGCTTGTGAAAGTTTGCCACAAAAAAAGAAAGGATGTAAGTTGTCCAATAAGGCAAGTT
CCCACAGGTAAAAAGCAGGTGCCTTTGAATCCTGACCTCAATCAAACAAAACCCGGAAAT
TTCCCGTCCCTTGCAGTTTCCAGTAATGAATTTGAACCTAGTAACAGCCATATGGTGAAG
TCTTACTCGTTGCTATTTAGAGTGACTCGTCCAGGAAGAAGAGAGTTTAATGGAATGATT
AATGGAGAAACCAATGAAAATATTGATGTCAATGAAGAGCTTCCAGCCAGAAGAAAACGA
AATCGTGAGGATGGGGAAAAGACATTTGTTGCACAAATGACAGTATTTGATAAAAACAGG
CGCTTACAGCTTTTAGATGGGGAATATGAAGTAGCCATGCAGGAAATGGAAGAATGTCCA
ATAAGCAAGAAAAGAGCAACATGGGAGACTATTCTTGATGGGAAGAGGCTGCCTCCATTC
GAAACATTTTCTCAGGGACCTACGTTGCAGTTCACTCTTCGTTGGACAGGAGAGACCAAT
GATAAATCTACGGCTCCTATTGCCAAACCTCTTGCCACTAGAAATTCAGAGAGTCTCCAT
CAGGAAAACAAGCCTGGTTCAGTTAAACCTACTCAAACTATTGCTGTTAAAGAATCATTG
ACTACAGATCTACAAACAAGAAAAGAAAAGGATACTCCAAATGAAAACCGACAAAAATTA
AGAATATTTTATCAGTTTCTCTATAACAACAATACAAGGCAACAAACTGAAGCAAGAGAT
GACCTGCATTGCCCTTGGTGTACTCTGAACTGCCGCAAACTTTATAGTTTACTCAAGCAT
CTTAAACTCTGCCATAGCAGATTTATCTTCAACTATGTTTATCATCCAAAAGGTGCTAGG
ATAGATGTTTCTATCAATGAGTGTTATGATGGCTCCTATGCAGGAAATCCTCAGGATATT
CATCGCCAACCTGGATTTGCTTTTAGTCGCAACGGACCAGTTAAGAGAACACCTATCACA
CATATTCTTGTGTGCAGGCCAAAACGAACAAAAGCAAGCATGTCTGAATTTCTTGAATCT
GAAGATGGGGAAGTAGAACAGCAAAGAACATATAGTAGTGGCCACAATCGTCTGTATTTC
CATAGTGATACCTGCTTACCTCTCCGTCCACAAGAAATGGAAGTAGATAGTGAAGATGAA
AAGGATCCTGAATGGCTAAGAGAAAAAACCATTACACAAATTGAAGAGTTTTCTGATGTT
AATGAAGGAGAGAAAGAAGTGATGAAACTCTGGAATCTCCATGTCATGAAGCATGGGTTT
ATTGCTGACAATCAAATGAATCATGCCTGTATGCTGTTTGTAGAAAATTATGGACAGAAA
ATAATTAAGAAGAATTTATGTCGAAACTTCATGCTTCATCTAGTCAGCATGCATGACTTT
AATCTTATTAGCATAATGTCAATAGATAAAGCTGTTACCAAGCTCCGTGAAATGCAGCAA
AAATTAGAAAAGGGGGAATCTGCTTCCCCTGCAAACGAAGAAATAACTGAAGAACAAAAT
GGGACAGCAAATGGATTTAGTGAAATTAACTCAAAAGAGAAAGCTTTGGAAACAGATAGT
GTCTCAGGGGTTTCAAAACAGAGCAAAAAACAAAAACTCTGAAAAGCTCTAACCCCATGT
TATGGACAAACACTGAAATTACATTTTAGGGAATTCATCCTCTAAGAATTATGTTTTTGT
TTTTAATCATATGTTCCAAACAGGCACTGTTAGATGAAGTAAATGATTTCAACAAGGATA
TTTGTATCAGGGTTCTACTTCACTTCATTATGCAGCATTACATGTATATCACTTTTATTG
ATGTCATTAAAACATTCTGTACTTTAAGCATGAAAAGCAATATTTCAAAGTATTTTTAAA
CTCAACAAATGTCATCAAATATGTTGAATTGATCTAGAAATTATTTCATATATAAATCAG
AATTTTTTTGCATTTATGAACGGCTGTTTTTCTACTTTGTAATTGTGAGACATTTTCTTG
GGGAGGGAAAATTGGAATGGTTCCCTTTTTTAGAAATTGAAGTGGTCTTCATATGTCAAC
TACAGAAAAGGAAAAAAATAGAAATTGAAGGATTTTTATGAAATTATATTGCATTACTAT
TTGCAGTCAAACTTTGATCCTTGTTTTTGAAATCATTTGTCAATTCGGAATGAAAAATTA
TAATGTAATTTTACATTACATAAGTTCCTTTTACAATTAAAAAATAGCACTTCTTCATCT
TATGCCTGTTTGAGAAGATATTAAATTTTCACATTGTTGACAGTGAAATGCTATGTTGGT
TTATAAGATTACAGACCATTTGTTTTCATGTGGATAATTTTAGTGCATTGCTCACCCGGT
ATGTTTTTTTTTTTTAACTTGAACATTTTGCTTGTTTTGTTTTTCTTTTTTAATTAGATA
ATCACACGGAAAATTAAGCTGTTCATATCTTTAAATTAGGATTGCAAACCAAGGAAAGAA
CGCATTTGAGATTTTAAGATGTCACTTATAAGGGGAGAAGTGTTCTTAAAAAGTCAACCA
GAAAACTGTTATGCCTTTTATTTGTTTGCAAGGATGTCTTTGTAATGTGTTTCATGAATA
GAATATCCAATAGAGATAAGCTGACTTGAATCATTTTGAGCAATTTTGCCCTGTGTTATA
TGTGTTTCACGCACATATTTGCAGTTGGATTTTCTCCAACAGAAAGTGGATTCACTACTG
GCACATTAACAAGCACCAATAGGTTTTTATTCCAACTCCGAGCACTGTGGTTGAGTAACA
TCACCTCAATTTTTTATTATCCTTAAAGATATTGCATTTTCATATTCTTTATTTATAAAG
GATCAATGCTGCTGTAAATACAGGTATTTTTAATTTTAAAATTTCATTCCACCACCATCA
GATGCAGTTCCCTATTTTGTTTAATGAAGGGATATATAAGCTTTCTAATGGTGTCTTCAG
AAATTTATAAAATGTAAATACTGATTTGACTGGTCTTTAAGATGTGTTTAACTGTGAGGC
TATTTAACGAATAGTGTGGATGTGATTTGTCATCCAGTATTAAGTTCTTAGTCATTGATT
TTTGTGTTTAAAAAAAAATAGGAAAGAGGGAAACTGCAGCTTTCATTACAGATTCCTTGA
TTGGTAAGCTCTCCAAATGATGAGTTCTAGTAAACTCTGATTTTTGCCTCTGGATAGTAG
ATCTCGAGCGTTTATCTCGGGCTTTAATTTGCTAAAGCTGTGCACATATGTAAAAAAAAA
AAAAAAAAGATTATTTTAGGGGAGATGTAGGTGTAGAATTATTGCTTATGTCATTTCTTA
AGCAGTTATGCTCTTAATGCTTAAAAGAAGGCTAGCATTGTTTGCACAAAAAGTTGGTGA
TTCCCACCCCAAATAGTAATAAAATTACTTCTGTTGAGTAAACTTTTTATGTCATCGTAA
AAGCTGAAAAAATCCCTTTGTTTCTATTTATAAAAAAAGTGCTTTTCTATATGTACCCTT
GATAACAGATTTTGAAGAAATCCTGTAAGATGATAAAGCATTTGAATGGTACAGTAGATG
TAAAAAAAATTCAGTTTAAAAGAACATTTGTTTTTACATTAAATGTTTATTTGAAATCAA
ATGATTTTGTACATAAAGTTCAATAATATAAAAGCTG

Protein Sequence

>23512 : length: 739
MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSA
AAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSH
RNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQN
SVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPS
NSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEKTFVAQMT
VFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLR
WTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPN
ENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVY
HPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASM
SEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQI
EEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHL
VSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPANEEITEEQNGTANGFSEINSKEK
ALETDSVSGVSKQSKKQKL