ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

23492

Name

CBX7

Synonym

chromobox homolog 7;CBX7;chromobox homolog 7

Definition

chromobox protein homolog 7

Position

22q13.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

23492

Links to epithelial mesenchymal transition gene database

23492

Links to ovarian cancer gene database

23492

Links to endometrial cancer gene database

23492

Links to iHOP

23492

Sequence Information

Nucleotide Sequence

>23492 : length: 4112
TCGCTGGCGCCGAGGAAAACGTTGCGCAGGTTCAAAAATGGAACGTCGGCGGCGTGAGGG
AGCGCGAGGGGGTGTGCGCGCGTGCGCGTGCGCGTGCGCGCCCGGACGAGGGTGACGGGG
ACCCCGCCAGCCCCAGCATCGCGCGCCGCAGCCGCGGCCCCGCAGCTCCGCCCCCGGCCC
GGCCCGGCCCCGGGCCCGCTCGCCCGCCGCCCCGCATGGAGCTGTCAGCCATCGGCGAGC
AGGTGTTCGCCGTGGAGAGCATCCGGAAGAAGCGCGTGCGGAAGGGTAAAGTCGAGTATC
TGGTGAAGTGGAAAGGATGGCCCCCAAAGTACAGCACGTGGGAGCCAGAAGAGCACATCT
TGGACCCCCGCCTCGTCATGGCCTACGAGGAGAAGTACGGTGTCCTCGGCACCGCCGGGG
AGGAGAGAGACCGAGCATCGGGGTATAGGAAGAGAGGTCCGAAACCCAAGCGGCTTCTGC
TGCAGCGGCTGTACAGCATGGACCTGCGGAGCTCCCACAAGGCCAAGGGCAAGGAGAAGC
TCTGCTTCTCCCTGACGTGCCCACTCGGCAGCGGGAGCCCTGAGGGGGTGGTCAAGGCGG
GGGCACCTGAGCTGGTGGACAAGGGCCCCTTGGTGCCCACCCTGCCCTTCCCGCTCCGCA
AGCCCCGAAAGGCCCACAAGTACCTGCGGCTCTCGCGCAAGAAGTTCCCGCCCCGCGGGC
CCAACCTGGAGAGCCACAGCCATCGACGGGAGCTCTTCCTGCAGGAGCCACCGGCCCCAG
ACGTCCTGCAGGCGGCTGGCGAGTGGGAGCCTGCTGCGCAGCCCCCTGAAGAGGAGGCAG
ATGCCGACCTGGCCGAGGGGCCCCCTCCCTGGACACCTGCGCTCCCCTCAAGTGAGGTGA
CCGTGACCGACATCACCGCCAACTCCATCACCGTCACCTTCCGCGAGGCCCAGGCAGCTG
AGGGCTTCTTCCGAGACCGCAGTGGGAAGTTCTGAATCACCGTTTTTACTCTTCTTAAAC
TGTTTTCTTTTGGGCTTGGGGTGGGACTTCCAGAGATAGGGATGGGTTGGGGGCGGGGTA
ATTATTTTATTTAAAAAAATACCGAGCAGCAAAAGGGGAGAAGATCCCACTACTCTCCCA
CCACCTGCCCTTTCTCTGAGGGACGTTTACCACGAGGCCTCAGGCTGGGGATGGAGAGAG
TTGCTCTGGGAGTTGGGGTACCACCCCCAGGGCAGGATGGGGACAGGATCACCTGCCCGG
GACACCACCATTATCATTCTCCTCTAGTGACGCAGCAGCTGGTTCTGGGAGTTAAAGGAG
CATTGGAAGGCCCAAACCCTCTCCCTTGAGTGGCCACCCCAGCCTGGTTGGCTGGTTTTC
CCCTTTTCTCTTGTTTCAATTGGGTCTTTACCTTGAACTCTCCTCTCTGGCTTTGCGGTG
GGCTGTGGAGGCTGGTTTTGACCAAAAGTGAGTGGGGCGGGAGGAAGGGGCAGGAGGAAG
GGTTGAGGTTACTTGGGGCGAGTCCCTTCCCCTTCAGAGAGGCTTCTATCCTTCCCAGGG
AGGAGGCGCCGCTGAGACCCTTCTGCTGAGAGCTCTGCCCTCCCCTCATCACCTGGCCTG
TGCAGAAACGCTCATGCACACCTGGCTGCACAGGTGTGCACGCATTACCCTTCGCGTGTA
CGTTCCCATGTGCCCCGTGAAAGCATGTGTGGCTGCAGACGTGTCCACATGGGCCTTGCG
AACCTGGGTTAGAAACCCTGGCCAGGCGAACGTGGGGTGATTCACAGCACAAAAGACCTC
ACCACCACACCTGCACTCACCCCACCTTGCATGCACCTTGCTACCTGCTTGCGGCTTTCA
GTGGAGGGCAGGGGTCTGGCACAGGTGCGATGGCACCCCATGCTCCAGGCATACAGATGT
GGTTTCTCGGCTGCACCGGGCCAGGCTGCGGGTGTGCAGGCGTCTGCTAAGTTGTGTGAT
GTATCAGCACAGGCTTTGAGACGTCTGGACCCTGTCCTTCCTCCCGTGAGGGGTTCTTGT
TCTTTCTGACTCAGGTGACTTTTCAGCCCTTCCAATTCCCCTCTTTTTCTGCCCTCCCCT
CCAACTCAGCCAACCCAGGTGTGGGCAGTCAGGGAGGGAGGGAGTGTCCCACCACGTTCT
CAGGGCAGCCCTTGACTCCTAAGCCCCTTCCTCCTTCCATTCTGCATCCCCTCCCCATCC
AACCTAAATGCCACAGCTGGGGCTGAGCTGTATTCCTGTGGAGGGACCTCTGCCGTGCCT
CTCTGAGGTCAGGCTGTGCTGTGTGATGGGCAGGCTTTGCCCCAGCCCACCCCTGGCAAG
GTGCACTTGTTTTCTGGTTTGTACAAGGTGTCCTGGGGGCCCGTGGCTTCCCTGCCAGTG
AGGAGTGACTTCTCCCTCTCTTCCAGTCCTGTAGGGGAGACAAAACCAGATTGGGGGGCC
CAAGGGGAGCATGGAAAAGGCCGGCTCCCCTGTCTTTCCTTGGCTGTCAGAGTCAGGGTA
ACACACACCAAGAGTGGAGTGCGGCCAGCAAGTTTGAGACCTGCCCGCCCTCCTCGCAGC
TCTGCTCTGTGTCCTCAGGAAGTCACAGAGTCTACTGAGGCAAGGAGAGGGTGATTCTTT
CCCCAAATCCCTTCTTCCCTGGTTCCCAAACCAAAGACAGCCTGCAGCCCTTTCTGCATG
GGGTGCTCTGTTGACAGGCTTCCCAGATCCCTGAGTCTCTCTTTCCTTCCTCCTCGATCT
TTAGTTGTCCACGGTCAATTCAGTGCTTCCATTGGGGGACAGTCCCCTCCGGGATGACCT
GATTCACCTCCAGCCCAGGGAATGGAATCTAGAGGAATACGTGGGGTGGGTCTGGACAAG
GAGCGGCAGGAATCACCACCCATCTCCAGCTGTGGAGCCCTGTGGAGGGGAAGGGGAAGC
TTGGGGTTCAGAGGGGACTCTTCCAGGAGAGGGGTGCCCAGCGGAGGTAAAGATGATAGA
GGGTTGTGGGGGGTCTCTAGTTGAATGTTTTGGCCCATGACTTTGGAACATGGCTGGCAG
CTTCCAGCAGAAGTCACGCTCCCCATCCCCCAGGGGACATAGGACCTTTTTCCTGCTTCC
TGGTCACTTTCAAAGAACTATTTGCGCAATCTGTGGGTCTGTGGATTCACGGGGCTTTCT
GTGTGGGTGCTGCAGTTGCTTTTGTCTGCAGCAGCAGGACACATCTTTCCTCTTACTCAG
CCCTTTATGGCCCATGGGGAACTCCGTGGCTCAGGGAGAGCTGAACTCCAGGGGTGTGAC
CTGGGACGGGTGGGCCTGAGGTGCCCAGCTCAGGGCAGCCAGGTGGCTCATGGGCTGTAG
TGAGCCAGCTCCCTGGGGGAAAAGGCTGTGGGCCGTTAGGACCATCCTCCAGGACAGGTG
ACCTCTATGAGGTCACCTACGGCTGTGGCCGTGCAGGCCTCCTTCCAGCCCAGAGTGGCC
CAGTAGAGCAAGGCAGACAGTGACCTCCACCCCCGCAGCCCTCTTAAAAGGCCAGTACTC
TTGGGGGTGGGGGGAGGGTTTAGAAAGCATTTGCCCATCTGCCTTTCTTTCCCCCAGCCC
CCACCCGCTTTGAATGTAGAGACCCGTGGGCACTTTTCCTTTTGTGGTGGGGGGTGCGGA
GGAGGTACCCCCACCCCTGGCACAGCCGCCTGGAATGCAGGACTGTCACTGCTGTTCGGG
TGATGACCTCGTTGCCAAGCTCCTCCTGTCCCCTTGTTCTGGGGGCAGGCGCTGTGCTTC
TGTGAGGTGGTTTAGCTTTTGCTTTCGAAGTGGCCAGCTGCGGCCACCAGGTCTCAGCAC
AAGAGCGCTTCCTTTGCACAGAATGAGCTTCGAGCTTTGTTCAGACTAAATGAATGTATC
TGGGAGGGGTCGGGGGCACGAGTTGATTCCAAGCACATGCCTTTGCTGAGTGTGTGTGTG
CTGGGAGAGTCAGAGTGGATGTAGAGCGCGGTTTTATTTTTGTACTGACATTGGTAAGAG
ACTGTATAGCATCTATTTATTTAGATGATTTATCTGGTAAATGAGGCAAAAAAATTATTA
AAAATACATTAAAGATGATTTAAAAAAAAGAA

Protein Sequence

>23492 : length: 259
MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEK
YGVLGTAGEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSG
SPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRREL
FLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITV
TFREAQAAEGFFRDRSGKF