ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

23476

Name

BRD4

Synonym

CAP|HUNK1|HUNKI|MCAP;bromodomain containing 4;BRD4;bromodomain containing 4

Definition

bromodomain-containing 4|bromodomain-containing protein 4|chromosome-associated protein

Position

19p13.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

23476

Links to epithelial mesenchymal transition gene database

23476

Links to ovarian cancer gene database

23476

Links to endometrial cancer gene database

23476

Links to iHOP

23476

Sequence Information

Nucleotide Sequence

>23476 : length: 5917
GTCAGTGCGCTGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCTGGGCTGTTTGTTCTGGTC
TCCCGCAGCCGAGGAGCCGAAGCAGTGGCGGCGGCAGCGGCTGCGGCGGCTGCCGGCGGT
GCCCGCGGGCGAGCGCGGCCTGTGAGCTCGGCAGAGCGGCGGGCGGGCCCCGGCGCCGCG
CAGGCAGCTCGGGGAGGGGGCGGCGGCAGCGGGCGGACGGCCGGCGGGGGCGGCGTGCGG
CCTAGCGTCTCAGAGTGCCTGGTGAAGAATGTGATGGGATCACTAGCATGTCTGCGGAGA
GCGGCCCTGGGACGAGATTGAGAAATCTGCCAGTAATGGGGGATGGACTAGAAACTTCCC
AAATGTCTACAACACAGGCCCAGGCCCAACCCCAGCCAGCCAACGCAGCCAGCACCAACC
CCCCGCCCCCAGAGACCTCCAACCCTAACAAGCCCAAGAGGCAGACCAACCAACTGCAAT
ACCTGCTCAGAGTGGTGCTCAAGACACTATGGAAACACCAGTTTGCATGGCCTTTCCAGC
AGCCTGTGGATGCCGTCAAGCTGAACCTCCCTGATTACTATAAGATCATTAAAACGCCTA
TGGATATGGGAACAATAAAGAAGCGCTTGGAAAACAACTATTACTGGAATGCTCAGGAAT
GTATCCAGGACTTCAACACTATGTTTACAAATTGTTACATCTACAACAAGCCTGGAGATG
ACATAGTCTTAATGGCAGAAGCTCTGGAAAAGCTCTTCTTGCAAAAAATAAATGAGCTAC
CCACAGAAGAAACCGAGATCATGATAGTCCAGGCAAAAGGAAGAGGACGTGGGAGGAAAG
AAACAGGGACAGCAAAACCTGGCGTTTCCACGGTACCAAACACAACTCAAGCATCGACTC
CTCCGCAGACCCAGACCCCTCAGCCGAATCCTCCTCCTGTGCAGGCCACGCCTCACCCCT
TCCCTGCCGTCACCCCGGACCTCATCGTCCAGACCCCTGTCATGACAGTGGTGCCTCCCC
AGCCACTGCAGACGCCCCCGCCAGTGCCCCCCCAGCCACAACCCCCACCCGCTCCAGCTC
CCCAGCCCGTACAGAGCCACCCACCCATCATCGCGGCCACCCCACAGCCTGTGAAGACAA
AGAAGGGAGTGAAGAGGAAAGCAGACACCACCACCCCCACCACCATTGACCCCATTCACG
AGCCACCCTCGCTGCCCCCGGAGCCCAAGACCACCAAGCTGGGCCAGCGGCGGGAGAGCA
GCCGGCCTGTGAAACCTCCAAAGAAGGACGTGCCCGACTCTCAGCAGCACCCAGCACCAG
AGAAGAGCAGCAAGGTCTCGGAGCAGCTCAAGTGCTGCAGCGGCATCCTCAAGGAGATGT
TTGCCAAGAAGCACGCCGCCTACGCCTGGCCCTTCTACAAGCCTGTGGACGTGGAGGCAC
TGGGCCTACACGACTACTGTGACATCATCAAGCACCCCATGGACATGAGCACAATCAAGT
CTAAACTGGAGGCCCGTGAGTACCGTGATGCTCAGGAGTTTGGTGCTGACGTCCGATTGA
TGTTCTCCAACTGCTATAAGTACAACCCTCCTGACCATGAGGTGGTGGCCATGGCCCGCA
AGCTCCAGGATGTGTTCGAAATGCGCTTTGCCAAGATGCCGGACGAGCCTGAGGAGCCAG
TGGTGGCCGTGTCCTCCCCGGCAGTGCCCCCTCCCACCAAGGTTGTGGCCCCGCCCTCAT
CCAGCGACAGCAGCAGCGATAGCTCCTCGGACAGTGACAGTTCGACTGATGACTCTGAGG
AGGAGCGAGCCCAGCGGCTGGCTGAGCTCCAGGAGCAGCTCAAAGCCGTGCACGAGCAGC
TTGCAGCCCTCTCTCAGCCCCAGCAGAACAAACCAAAGAAAAAGGAGAAAGACAAGAAGG
AAAAGAAAAAAGAAAAGCACAAAAGGAAAGAGGAAGTGGAAGAGAATAAAAAAAGCAAAG
CCAAGGAACCTCCTCCTAAAAAGACGAAGAAAAATAATAGCAGCAACAGCAATGTGAGCA
AGAAGGAGCCAGCGCCCATGAAGAGCAAGCCCCCTCCCACGTATGAGTCGGAGGAAGAGG
ACAAGTGCAAGCCTATGTCCTATGAGGAGAAGCGGCAGCTCAGCTTGGACATCAACAAGC
TCCCCGGCGAGAAGCTGGGCCGCGTGGTGCACATCATCCAGTCACGGGAGCCCTCCCTGA
AGAATTCCAACCCCGACGAGATTGAAATCGACTTTGAGACCCTGAAGCCGTCCACACTGC
GTGAGCTGGAGCGCTATGTCACCTCCTGTTTGCGGAAGAAAAGGAAACCTCAAGCTGAGA
AAGTTGATGTGATTGCCGGCTCCTCCAAGATGAAGGGCTTCTCGTCCTCAGAGTCGGAGA
GCTCCAGTGAGTCCAGCTCCTCTGACAGCGAAGACTCCGAAACAGAGATGGCTCCGAAGT
CAAAAAAGAAGGGGCACCCCGGGAGGGAGCAGAAGAAGCACCATCATCACCACCATCAGC
AGATGCAGCAGGCCCCGGCTCCTGTGCCCCAGCAGCCGCCCCCGCCTCCCCAGCAGCCCC
CACCGCCTCCACCTCCGCAGCAGCAACAGCAGCCGCCACCCCCGCCTCCCCCACCCTCCA
TGCCGCAGCAGGCAGCCCCGGCGATGAAGTCCTCGCCCCCACCCTTCATTGCCACCCAGG
TGCCCGTCCTGGAGCCCCAGCTCCCAGGCAGCGTCTTTGACCCCATCGGCCACTTCACCC
AGCCCATCCTGCACCTGCCGCAGCCTGAGCTGCCCCCTCACCTGCCCCAGCCGCCTGAGC
ACAGCACTCCACCCCATCTCAACCAGCACGCAGTGGTCTCTCCTCCAGCTTTGCACAACG
CACTACCCCAGCAGCCATCACGGCCCAGCAACCGAGCCGCTGCCCTGCCTCCCAAGCCCG
CCCGGCCCCCAGCCGTGTCACCAGCCTTGACCCAAACACCCCTGCTCCCACAGCCCCCCA
TGGCCCAACCCCCCCAAGTGCTGCTGGAGGATGAAGAGCCACCTGCCCCACCCCTCACCT
CCATGCAGATGCAGCTGTACCTGCAGCAGCTGCAGAAGGTGCAGCCCCCTACGCCGCTAC
TCCCTTCCGTGAAGGTGCAGTCCCAGCCCCCACCCCCCCTGCCGCCCCCACCCCACCCCT
CTGTGCAGCAGCAGCTGCAGCAGCAGCCGCCACCACCCCCACCACCCCAGCCCCAGCCTC
CACCCCAGCAGCAGCATCAGCCCCCTCCACGGCCCGTGCACTTGCAGCCCATGCAGTTTT
CCACCCACATCCAACAGCCCCCGCCACCCCAGGGCCAGCAGCCCCCCCATCCGCCCCCAG
GCCAGCAGCCACCCCCGCCGCAGCCTGCCAAGCCTCAGCAAGTCATCCAGCACCACCATT
CACCCCGGCACCACAAGTCGGACCCCTACTCAACCGGTCACCTCCGCGAAGCCCCCTCCC
CGCTTATGATACATTCCCCCCAGATGTCACAGTTCCAGAGCCTGACCCACCAGTCTCCAC
CCCAGCAAAACGTCCAGCCTAAGAAACAGGAGCTGCGTGCTGCCTCCGTGGTCCAGCCCC
AGCCCCTCGTGGTGGTGAAGGAGGAGAAGATCCACTCACCCATCATCCGCAGCGAGCCCT
TCAGCCCCTCGCTGCGGCCGGAGCCCCCCAAGCACCCGGAGAGCATCAAGGCCCCCGTCC
ACCTGCCCCAGCGGCCGGAAATGAAGCCTGTGGATGTCGGGAGGCCTGTGATCCGGCCCC
CAGAGCAGAACGCACCGCCACCAGGGGCCCCTGACAAGGACAAACAGAAACAGGAGCCGA
AGACTCCAGTTGCGCCCAAAAAGGACCTGAAAATCAAGAACATGGGCTCCTGGGCCAGCC
TAGTGCAGAAGCATCCGACCACCCCCTCCTCCACAGCCAAGTCATCCAGCGACAGCTTCG
AGCAGTTCCGCCGCGCCGCTCGGGAGAAAGAGGAGCGTGAGAAGGCCCTGAAGGCTCAGG
CCGAGCACGCTGAGAAGGAGAAGGAGCGGCTGCGGCAGGAGCGCATGAGGAGCCGAGAGG
ACGAGGATGCGCTGGAGCAGGCCCGGCGGGCCCATGAGGAGGCACGTCGGCGCCAGGAGC
AGCAGCAGCAGCAGCGCCAGGAGCAACAGCAGCAGCAGCAACAGCAAGCAGCTGCGGTGG
CTGCCGCCGCCACCCCACAGGCCCAGAGCTCCCAGCCCCAGTCCATGCTGGACCAGCAGA
GGGAGTTGGCCCGGAAGCGGGAGCAGGAGCGAAGACGCCGGGAAGCCATGGCAGCTACCA
TTGACATGAATTTCCAGAGTGATCTATTGTCAATATTTGAAGAAAATCTTTTCTGAGCGC
ACCTAGGTGGCTTCTGACTTTGATTTTCTGGCAAAACATTGACTTTCCATAGTGTTAGGG
GCGGTGGTGGAGGTGGGATCAGCGGCCAGGGGATGCCTCAGGGCCTGGCCCTCCTGCATG
CTATGCCCGGGGCAGGCCTGACGGGCAGCTGAGGATTGCAGAGCCTGTCTGCCTTACGGC
CAGTCGGACAGACGTCCCGCCACCCACCACCCCTCACAGGACGTCCGCTCAGCACACGCC
TTGTTACGAGCAAGTGCCGGCTGGACCCAAGCCCTGCATCCCCACATGCGGGGCAGAGGC
CCTTCTCTCCGCCAAATGTCTACACAGTATACACAGGACATCGTTGCTGCCGCCGTGACT
GGTTTTCTGTCCCCAAGAACGTGACGTTCGTGATGTCCTGCCCGCCGGGAGTCTTTCCCC
ACACCCCAGCCATCGCCGCCCGCTCCCAGGAGGCCAGGGCAGGCCTGCGTGGGCTGGAGG
CGGGCGAGGCCGGCCCACCCCCTCGCTGGCACTGACTTTGCCTTGAACAGACCCCCCGAC
CCTCCCCCACAAGCCTTTAATTGAGAGCCGCTCTCTGTAAGTGTTTGCTTGTGCAAAAGG
GAATAGTGCCGTGGAGGTGTGTGTGTCCATGGCATCCGGAGCGAGGCGACTGTCCTGCGT
GGGTAGCCCTCGGCCGGGGAGTGAGGCCACCAACCAAAGTCAGTTCCTTCCCACCTGTGT
TTCTGTTTCGTTTTTTTTTTTCTTTTTTTTCTATATATATTTTTTGTTGAATTCTATTTT
ATTTTTAATTCTCTCTTCTCCTCCAGACACAATGGCACTGCTTATCTCCGAAATGGTGTG
ATCGTCTCCTCATTGAGCAGCGGCTGCCACCGCGCTGTGGGTAGTGTGTGACCGTGGCTG
TACTGTATAGTGAACATAGTTGGCATATCTTTGTTTGAAGTTTGTTGGTGACTCCACCAA
ACTGGTGTGAAAAAAGAAAAAAGCTCAAAAAAATCCACAAAAAGACAAAACACACAAAAA
AAATCCTGCCTATATTTTACTCAGTTTCAAACTTTATTAGTCTATTTTTAATTATAAAAC
CAGAAAGCTACAATTTCTTTTCTTTCCCCTCCACCCCCCCCCCCCCCACCCATTTGTTGG
CTTTTTTGTTTTTTAATGTCAGATCTGTTGAGTTGGTTTTTTTGGTTTTGGTTTTTGTTT
TTGTTTTTGTTTTTTACTGAGAAAGGAAGGGCCAAGGGATGAGGTGGGAACCGGGCCCTG
GGGGCGCCACAGACTAAGGCAGAGACTCCCCTACCTGGCGCCCAGCCCCAACCAGCTGGC
CGCTCCTGCCCATGCTTTTTTTTTTTTTTTTTTTTAATTTTTATAATTGGAGCCCCTGGT
GAGGTTACGCGTGCCATGAGAACCCACTCTACACCACGACGCTGGTGCCTCAGTGTTGGC
CAAACTCTGGAGTCACTGACTGGTTTGACTTTCATACGGTGAATATGCATTTGGTCTGTA
CTGATCATGGAATAAACACATCTCTCTTTTTTTAATG

Protein Sequence

>23476 : length: 1362
MSAESGPGTRLRNLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPKRQT
NQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYW
NAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETEIMIVQAKGRG
RGRKETGTAKPGVSTVPNTTQASTPPQTQTPQPNPPPVQATPHPFPAVTPDLIVQTPVMT
VVPPQPLQTPPPVPPQPQPPPAPAPQPVQSHPPIIAATPQPVKTKKGVKRKADTTTPTTI
DPIHEPPSLPPEPKTTKLGQRRESSRPVKPPKKDVPDSQQHPAPEKSSKVSEQLKCCSGI
LKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGA
DVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEEPVVAVSSPAVPPPTKVV
APPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQLKAVHEQLAALSQPQQNKPKKKE
KDKKEKKKEKHKRKEEVEENKKSKAKEPPPKKTKKNNSSNSNVSKKEPAPMKSKPPPTYE
SEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLK
PSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSSSESESSSESSSSDSEDSETE
MAPKSKKKGHPGREQKKHHHHHHQQMQQAPAPVPQQPPPPPQQPPPPPPPQQQQQPPPPP
PPPSMPQQAAPAMKSSPPPFIATQVPVLEPQLPGSVFDPIGHFTQPILHLPQPELPPHLP
QPPEHSTPPHLNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPARPPAVSPALTQTPLL
PQPPMAQPPQVLLEDEEPPAPPLTSMQMQLYLQQLQKVQPPTPLLPSVKVQSQPPPPLPP
PPHPSVQQQLQQQPPPPPPPQPQPPPQQQHQPPPRPVHLQPMQFSTHIQQPPPPQGQQPP
HPPPGQQPPPPQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLT
HQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPKHPESI
KAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPPGAPDKDKQKQEPKTPVAPKKDLKIKNMG
SWASLVQKHPTTPSSTAKSSSDSFEQFRRAAREKEEREKALKAQAEHAEKEKERLRQERM
RSREDEDALEQARRAHEEARRRQEQQQQQRQEQQQQQQQQAAAVAAAATPQAQSSQPQSM
LDQQRELARKREQERRRREAMAATIDMNFQSDLLSIFEENLF