ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

23411

Name

SIRT1

Synonym

SIR2|SIR2L1|hSIR2;sirtuin 1;SIRT1;sirtuin 1

Definition

NAD-dependent deacetylase sirtuin-1|NAD-dependent protein deacetylase sirtuin-1|SIR2-like protein 1|SIR2alpha|regulatory protein SIR2 homolog 1|sir2-like 1|sirtuin type 1

Position

10q21.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Regulation of retinoblastoma protein;PID Curated;200191

Pathway

E2F transcription factor network;PID Curated;200027

Pathway

p53 pathway;PANTHER;P00059

Pathway

Signaling events mediated by HDAC Class III;PID Curated;200020

Pathway

Regulation of Androgen receptor activity;PID Curated;200102

Pathway

regulation of transcriptional activity by pml;PID BioCarta;100067

Pathway

HIF-2-alpha transcription factor network;PID Curated;200030

Pathway

FoxO family signaling;PID Curated;200091

External Links

Links to cell senescence gene database

23411

Links to epithelial mesenchymal transition gene database

23411

Links to ovarian cancer gene database

23411

Links to endometrial cancer gene database

23411

Links to iHOP

23411

Sequence Information

Nucleotide Sequence

>23411 : length: 4110
GTCGAGCGGGAGCAGAGGAGGCGAGGGAGGAGGGCCAGAGAGGCAGTTGGAAGATGGCGG
ACGAGGCGGCCCTCGCCCTTCAGCCCGGCGGCTCCCCCTCGGCGGCGGGGGCCGACAGGG
AGGCCGCGTCGTCCCCCGCCGGGGAGCCGCTCCGCAAGAGGCCGCGGAGAGATGGTCCCG
GCCTCGAGCGGAGCCCGGGCGAGCCCGGTGGGGCGGCCCCAGAGCGTGAGGTGCCGGCGG
CGGCCAGGGGCTGCCCGGGTGCGGCGGCGGCGGCGCTGTGGCGGGAGGCGGAGGCAGAGG
CGGCGGCGGCAGGCGGGGAGCAAGAGGCCCAGGCGACTGCGGCGGCTGGGGAAGGAGACA
ATGGGCCGGGCCTGCAGGGCCCATCTCGGGAGCCACCGCTGGCCGACAACTTGTACGACG
AAGACGACGACGACGAGGGCGAGGAGGAGGAAGAGGCGGCGGCGGCGGCGATTGGGTACC
GAGATAACCTTCTGTTCGGTGATGAAATTATCACTAATGGTTTTCATTCCTGTGAAAGTG
ATGAGGAGGATAGAGCCTCACATGCAAGCTCTAGTGACTGGACTCCAAGGCCACGGATAG
GTCCATATACTTTTGTTCAGCAACATCTTATGATTGGCACAGATCCTCGAACAATTCTTA
AAGATTTATTGCCGGAAACAATACCTCCACCTGAGTTGGATGATATGACACTGTGGCAGA
TTGTTATTAATATCCTTTCAGAACCACCAAAAAGGAAAAAAAGAAAAGATATTAATACAA
TTGAAGATGCTGTGAAATTACTGCAAGAGTGCAAAAAAATTATAGTTCTAACTGGAGCTG
GGGTGTCTGTTTCATGTGGAATACCTGACTTCAGGTCAAGGGATGGTATTTATGCTCGCC
TTGCTGTAGACTTCCCAGATCTTCCAGATCCTCAAGCGATGTTTGATATTGAATATTTCA
GAAAAGATCCAAGACCATTCTTCAAGTTTGCAAAGGAAATATATCCTGGACAATTCCAGC
CATCTCTCTGTCACAAATTCATAGCCTTGTCAGATAAGGAAGGAAAACTACTTCGCAACT
ATACCCAGAACATAGACACGCTGGAACAGGTTGCGGGAATCCAAAGGATAATTCAGTGTC
ATGGTTCCTTTGCAACAGCATCTTGCCTGATTTGTAAATACAAAGTTGACTGTGAAGCTG
TACGAGGAGATATTTTTAATCAGGTAGTTCCTCGATGTCCTAGGTGCCCAGCTGATGAAC
CGCTTGCTATCATGAAACCAGAGATTGTGTTTTTTGGTGAAAATTTACCAGAACAGTTTC
ATAGAGCCATGAAGTATGACAAAGATGAAGTTGACCTCCTCATTGTTATTGGGTCTTCCC
TCAAAGTAAGACCAGTAGCACTAATTCCAAGTTCCATACCCCATGAAGTGCCTCAGATAT
TAATTAATAGAGAACCTTTGCCTCATCTGCATTTTGATGTAGAGCTTCTTGGAGACTGTG
ATGTCATAATTAATGAATTGTGTCATAGGTTAGGTGGTGAATATGCCAAACTTTGCTGTA
ACCCTGTAAAGCTTTCAGAAATTACTGAAAAACCTCCACGAACACAAAAAGAATTGGCTT
ATTTGTCAGAGTTGCCACCCACACCTCTTCATGTTTCAGAAGACTCAAGTTCACCAGAAA
GAACTTCACCACCAGATTCTTCAGTGATTGTCACACTTTTAGACCAAGCAGCTAAGAGTA
ATGATGATTTAGATGTGTCTGAATCAAAAGGTTGTATGGAAGAAAAACCACAGGAAGTAC
AAACTTCTAGGAATGTTGAAAGTATTGCTGAACAGATGGAAAATCCGGATTTGAAGAATG
TTGGTTCTAGTACTGGGGAGAAAAATGAAAGAACTTCAGTGGCTGGAACAGTGAGAAAAT
GCTGGCCTAATAGAGTGGCAAAGGAGCAGATTAGTAGGCGGCTTGATGGTAATCAGTATC
TGTTTTTGCCACCAAATCGTTACATTTTCCATGGCGCTGAGGTATATTCAGACTCTGAAG
ATGACGTCTTATCCTCTAGTTCTTGTGGCAGTAACAGTGATAGTGGGACATGCCAGAGTC
CAAGTTTAGAAGAACCCATGGAGGATGAAAGTGAAATTGAAGAATTCTACAATGGCTTAG
AAGATGAGCCTGATGTTCCAGAGAGAGCTGGAGGAGCTGGATTTGGGACTGATGGAGATG
ATCAAGAGGCAATTAATGAAGCTATATCTGTGAAACAGGAAGTAACAGACATGAACTATC
CATCAAACAAATCATAGTGTAATAATTGTGCAGGTACAGGAATTGTTCCACCAGCATTAG
GAACTTTAGCATGTCAAAATGAATGTTTACTTGTGAACTCGATAGAGCAAGGAAACCAGA
AAGGTGTAATATTTATAGGTTGGTAAAATAGATTGTTTTTCATGGATAATTTTTAACTTC
ATTATTTCTGTACTTGTACAAACTCAACACTAACTTTTTTTTTTTTAAAAAAAAAAAGGT
ACTAAGTATCTTCAATCAGCTGTTGGTCAAGACTAACTTTCTTTTAAAGGTTCATTTGTA
TGATAAATTCATATGTGTATATATAATTTTTTTTGTTTTGTCTAGTGAGTTTCAACATTT
TTAAAGTTTTCAAAAAGCCATCGGAATGTTAAATTAATGTAAAGGGAACAGCTAATCTAG
ACCAAAGAATGGTATTTTCACTTTTCTTTGTAACATTGAATGGTTTGAAGTACTCAAAAT
CTGTTACGCTAAACTTTTGATTCTTTAACACAATTATTTTTAAACACTGGCATTTTCCAA
AACTGTGGCAGCTAACTTTTTAAAATCTCAAATGACATGCAGTGTGAGTAGAAGGAAGTC
AACAATATGTGGGGAGAGCACTCGGTTGTCTTTACTTTTAAAAGTAATACTTGGTGCTAA
GAATTTCAGGATTATTGTATTTACGTTCAAATGAAGATGGCTTTTGTACTTCCTGTGGAC
ATGTAGTAATGTCTATATTGGCTCATAAAACTAACCTGAAAAACAAATAAATGCTTTGGA
AATGTTTCAGTTGCTTTAGAAACATTAGTGCCTGCCTGGATCCCCTTAGTTTTGAAATAT
TTGCCATTGTTGTTTAAATACCTATCACTGTGGTAGAGCTTGCATTGATCTTTTCCACAA
GTATTAAACTGCCAAAATGTGAATATGCAAAGCCTTTCTGAATCTATAATAATGGTACTT
CTACTGGGGAGAGTGTAATATTTTGGACTGCTGTTTTCCATTAATGAGGAGAGCAACAGG
CCCCTGATTATACAGTTCCAAAGTAATAAGATGTTAATTGTAATTCAGCCAGAAAGTACA
TGTCTCCCATTGGGAGGATTTGGTGTTAAATACCAAACTGCTAGCCCTAGTATTATGGAG
ATGAACATGATGATGTAACTTGTAATAGCAGAATAGTTAATGAATGAAACTAGTTCTTAT
AATTTATCTTTATTTAAAAGCTTAGCCTGCCTTAAAACTAGAGATCAACTTTCTCAGCTG
CAAAAGCTTCTAGTCTTTCAAGAAGTTCATACTTTATGAAATTGCACAGTAAGCATTTAT
TTTTCAGACCATTTTTGAACATCACTCCTAAATTAATAAAGTATTCCTCTGTTGCTTTAG
TATTTATTACAATAAAAAGGGTTTGAAATATAGCTGTTCTTTATGCATAAAACACCCAGC
TAGGACCATTACTGCCAGAGAAAAAAATCGTATTGAATGGCCATTTCCCTACTTATAAGA
TGTCTCAATCTGAATTTATTTGGCTACACTAAAGAATGCAGTATATTTAGTTTTCCATTT
GCATGATGTTTGTGTGCTATAGATGATATTTTAAATTGAAAAGTTTGTTTTAAATTATTT
TTACAGTGAAGACTGTTTTCAGCTCTTTTTATATTGTACATAGTCTTTTATGTAATTTAC
TGGCATATGTTTTGTAGACTGTTTAATGACTGGATATCTTCCTTCAACTTTTGAAATACA
AAACCAGTGTTTTTTACTTGTACACTGTTTTAAAGTCTATTAAAATTGTCATTTGACTTT
TTTCTGTTAACTTAAAAAAAAAAAAAAAAA

Protein Sequence

>23411 : length: 747
MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREV
PAAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNL
YDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRP
RIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDI
NTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIE
YFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRII
QCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPE
QFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLG
DCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSS
PERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDL
KNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSD
SEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTD
GDDQEAINEAISVKQEVTDMNYPSNKS