ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

23373

Name

CRTC1

Synonym

MECT1|TORC-1|TORC1|WAMTP1;CREB regulated transcription coactivator 1;CRTC1;CREB regulated transcription coactivator 1

Definition

CREB-regulated transcription coactivator 1|mucoepidermoid carcinoma translocated protein 1|transducer of regulated cAMP response element-binding protein (CREB) 1

Position

19p13.11

Gene Type

protein-coding

Pathways and Diseases

Pathway

AP-1 transcription factor network;PID Curated;200118

Disease

Mucoepidermoid salivary gland carcinoma;OMIM

External Links

Links to cell senescence gene database

23373

Links to epithelial mesenchymal transition gene database

23373

Links to ovarian cancer gene database

23373

Links to endometrial cancer gene database

23373

Links to iHOP

23373

Sequence Information

Nucleotide Sequence

>23373 : length: 7009
CCAGCCGGCGCTTGCGCGGTGGCACGGGCGAGTGGGGGGGCGAGGAGGTGGAGGAGGAGG
AGGAGGAGGAGGAGGTGGCGGCGAGAAGATGGCGACTTCGAACAATCCGCGGAAATTCAG
CGAGAAGATCGCGCTGCACAATCAGAAGCAGGCGGAGGAGACGGCGGCCTTCGAGGAGGT
CATGAAGGACCTGAGCCTGACGCGGGCCGCGCGGCTCCAGCTCCAGAAATCCCAGTACCT
GCAACTGGGCCCCAGCCGAGGCCAGTACTATGGCGGGTCCCTGCCCAACGTGAACCAGAT
CGGGAGTGGCACCATGGACCTGCCCTTCCAGCCCAGCGGATTTCTGGGGGAGGCCCTGGC
AGCGGCTCCTGTCTCTCTGACCCCCTTCCAATCCTCGGGCCTGGACACCAGCCGGACCAC
CCGGCACCATGGGCTGGTGGACAGGGTGTACCGGGAGCGTGGCCGGCTCGGCTCCCCACA
CCGCCGGCCCCTGTCAGTGGACAAACACGGACGGCAGGCCGACAGCTGCCCCTATGGCAC
CATGTACCTCTCACCACCCGCGGACACCAGCTGGAGAAGGACCAATTCTGACTCCGCCCT
GCACCAGAGCACAATGACGCCCACGCAGCCAGAATCCTTTAGCAGTGGGTCCCAGGACGT
GCACCAGAAAAGAGTCTTACTGTTAACAGTCCCAGGAATGGAAGAGACCACATCAGAGGC
AGACAAAAACCTTTCCAAGCAAGCATGGGACACCAAGAAGACGGGGTCCAGGCCCAAGTC
CTGTGAGGTCCCCGGAATCAACATCTTCCCGTCTGCCGACCAGGAAAACACTACAGCCCT
GATCCCCGCCACCCACAACACAGGGGGGTCCCTGCCCGACCTGACCAACATCCACTTCCC
CTCCCCGCTCCCGACCCCGCTGGACCCCGAGGAGCCCACCTTCCCTGCACTGAGCAGCTC
CAGCAGCACCGGCAACCTCGCGGCCAACCTGACGCACCTGGGCATCGGTGGCGCCGGCCA
GGGAATGAGCACACCTGGCTCCTCTCCACAGCACCGCCCAGCTGGCGTCAGCCCCCTGTC
CCTGAGCACAGAGGCAAGGCGTCAGCAGGCATCGCCCACCCTGTCCCCGCTGTCACCCAT
CACTCAGGCTGTAGCCATGGACGCCCTGTCTCTGGAGCAGCAGCTGCCCTACGCCTTCTT
CACCCAGGCGGGCTCCCAGCAGCCACCGCCGCAGCCCCAGCCCCCGCCGCCTCCTCCACC
CGCGTCCCAGCAGCCACCACCCCCGCCACCCCCACAGGCGCCCGTCCGCCTGCCCCCTGG
TGGCCCCCTGTTGCCCAGCGCCAGCCTGACTCGTGGGCCACAGCCGCCCCCGCTTGCAGT
CACGGTACCGTCCTCTCTCCCCCAGTCCCCCCCAGAGAACCCTGGCCAGCCATCGATGGG
GATCGACATCGCCTCGGCGCCGGCTCTGCAGCAGTACCGCACTAGCGCCGGCTCCCCGGC
CAACCAGTCTCCCACCTCGCCAGTCTCCAATCAAGGCTTCTCCCCAGGGAGCTCCCCGCA
ACACACTTCCACCCTGGGCAGCGTGTTTGGGGACGCGTACTATGAGCAGCAGATGGCGGC
CAGGCAGGCCAATGCTCTGTCCCACCAGCTGGAGCAGTTCAACATGATGGAGAACGCCAT
CAGCTCCAGCAGCCTGTACAGCCCGGGCTCCACACTCAACTACTCGCAGGCGGCCATGAT
GGGCCTCACGGGCAGCCACGGGAGCCTGCCGGACTCGCAGCAACTGGGATACGCCAGCCA
CAGTGGCATCCCCAACATCATCCTCACAGTGACAGGAGAGTCCCCCCCCAGCCTCTCTAA
AGAACTGACCAGCTCTCTGGCCGGGGTCGGCGACGTCAGCTTCGACTCCGACAGCCAGTT
TCCCCTGGACGAACTCAAGATCGACCCCCTGACCCTCGACGGACTGCACATGCTCAACGA
CCCCGACATGGTTCTGGCCGACCCAGCCACCGAGGACACCTTCCGGATGGACCGCCTGTG
AGCGGGCACGCCGGCACCCTGCCGCTCAGCCGTCCCGACGGCGCCTCCCCAGCCCGGGGA
CGGCCGTGCTCCGTCCCTCGCCAACGGCCGAGCTTGTGATTCTGAGCTTGCAATGCCGCC
AAGCGCCCCCCGCCAGCCCGCCCCCGGTTGTCCACCTCCCGCGAAGCCCAATCGCGAGGC
CGCGAGCCGGGCCGTCCACCCACCCGCCCGCCCAGGGCTGGGCTGGGATCGGAGGCCGTG
AGCCTCCCGCCCCTGCAGACCCTCCCTGCACTGGCTCCCTCGCCCCCAGCCCCGGGGCCT
GAGCCGTCCCCTGTAAGATGCGGGAAGTGTCAGCTCCCGGCGTGGCGGGCAGGCTCAGGG
GAGGGGCGCGCATGGTCCGCCAGGGCTGTGGGCCGTGGCGCATTTTCCGACTGTTTGTCC
AGCTCTCACTGCCTTCCTTGGTTCCCGGTCCCCCAGCCCATCCGCCATCCCCAGCCCGTG
GTCAGGTAGAGAGTGAGCCCCACGCCGCCCCAGGGAGGAGGCGCCAGAGCGCGGGGCAGA
CGCAAAGTGAAATAAACACTATTTTGACGGCTGTCTTTTATATTTCTGAGCACACACAGA
GCCCTGGCGTCCACCGGGGCAGGCGCAAAGTGGACAGAGCATGCAGGGCGGCGGACCCCC
CCACGACCCTCCTCGCCCTGTCTCCATCCCCTCGAAGCCCTGCCTCACCGCAGGCAGGCC
CATCGGTGGCCACCTTTGCCGGGAAGTGACCGGAAGGCCCCGTGAGGGGTCGAACGCGGA
GGCAGGGGTTACCTCTTGGGGCTTTACAATCCGTGGCCCCTCCTGTCCTGCACTGTGGTC
ACCGGTCCTGTCATAGATGCTGTTAATTTAAGGTACAGGCAGAGGTGGCCAGGGGAGTTT
CATTGTGGTTTTTTTTTCCTTTTAGTTTCTAGTTACATTTTGGTTGTAGATGACTCGCTT
AATCTTTTAAGCCAACACTTGCCTGAGAGCATGTTTTTATTTCAGAAATCCAACTTTACC
TATTTTTTAAGCTAACTGGAAATGGAGGCCATGCGCCCCAAAGCAGCCCGCCACCCACCT
GAGTGTAAGAAGTGAGTCCGGCTTTTGGGTTTCACCCCAAGTTATCTCAAAACAAAAGGG
CTGGTCAGGCTGGGCAGGGCCTTGTCAGGAGCTCACGGTAGGCAGAGGTGCCTCTGCCAG
GGCCACAGAACAGACTTCCGGGAAGGGGCCTTGGCTTTTATTGAGGGTCTCTCAAAGACC
CAGCCTGCCAGCCTCTCCCAGAGGTGCCTGCTAGTCCTTAGAGTGTGTGTGTGAAGATGC
CATGACCAGTGGCAGCTGAGACCTCTCTGCCCCAAGAGTGTGGGGGACTGGCAGGGAGCG
AGGGTCCCCGAGACGAGGACCACGGTCCTCCCTGAGAACCTGGGTGGAACTGGCATTTCA
TCCCCTCTCCACCCTACCCTCTGGCTCCTAGCCCACACCCCCTCTCTTGGGCAGCGTGGT
CTGCTGGCTGCCCCTTCTTGGCAGCTCAGGGTCGTGGCAGGTGGACTTGGAGACACACAG
CAGTGTGTGTTTTAGTGGCAGGTTTCAGGAGCACCTCTAAGACCAGGGTGACAGGGTACT
TGGGAGCTGTCCTGGACCCTCCCCATACCACGGGCCCTGCAAGGGAGGCATCAGGGCTGG
CTTTGTTTTCTGCTGTTCTTGGAATAGGAACTGCTGTTCTGATCCCCCCAAAACTGCATT
GCGGCTCTCGCTCGCTCCTGCCTGCCGGGACAGCGCCTTCTGCTGAGTCCGTTTATTTGT
AGTGTCATGGCTGCTGCTTTCACTGGGGTCCTGGGCACCCTGGCTTCTGTCCTCAGAGCT
GGGTTTGATCCTAGCAACCATCCCTTCCTCTCTTTGCCCGGCAATGCCTTTGGCATGTGT
CTGAGCAGCCAAGTGGCCACTCATAGGAGAAGGCTCCCTGGTCACGTTGCTCCTGCTGCC
GTCTTGTTCCAAGGTGCGGGGGGGACACTGTTGGTCTGTCCAGGTCAAGGTCCCTTTCTC
TTACCATGACAGAGGCTGGGGGCAGACAGCGGGGACTTTTTTTTTTTTTTAAGAAAAACT
ACATGTACATAGGAGAGTTTCATTACCATTAGACTTGTATGTAGGACTTAAAAAAAAATG
GCCTTAATAAAATTACAAGCAACCCGCCTGGATGCGGTTTTCAAAAGAAGGCATTGAGGA
CCATGCTAGGAAACCTCATACCCCATCCGTCCAACCTCCGGCGGGCGCCACTGCTTGTCC
TCTGGTCTTCGGTGTGGACAGATAGGAGAGGAGGGATGCCCACCTCGGAGCATCCCAGGC
CCGTGGCCCATTTTCAGCATCCTGAAGCCAGATTCACAGTGACATTGTGTTAACGTGACG
ACCTTGGTCCATTATGGAGTTCTTTTTCCAATAAGAACCTGGTGGACCGAGGTCCGAGCT
TGCCAGGGACAGTGGGGCCCACGCGAGTACCCGGGGCCCAGCCAGGAGCCAGCAGCCAGG
CGTCCCTGTGTTCCAGAAGGATTCACGCCCCTCCTGGACCTGGGCGGGCCTCCCAGGGGG
TCTGTATCACGGCCTTTTGTGTGTGCGTACGTGTGGTTTTTTTAAATATCACTACTACAT
ATTCTTGAATTGCCAAGACTTTCTGAAACAAGACAGCTTAAGGGAATCAGCCTTTTGCTT
TGTGATGTGAAAATACTGTGATTTGACGAGCCGCTTCCTGAGGGGCAGGCCCACGTGGGG
AGGTTGCGCCGTGTACATAGACCCGCCGTCTGTGTCCTTGGTCAGGCCCGGATGCTTGGT
CTACACTGGGTTAGAGGCTGCTCTCCCCACGCACCCATGTGCTCATGGCTTCTGCAGACC
CTCTGCTGGGTACATCGGTCCCCTACGGCGAAGTTCAGCCAGGGCTCTCCCTCCTGAGAG
CATGGCGTCCCCACCTTCCTGTTTCGCCGACGTCACTACCCAGGGTGGCAAGTCTTGCAG
GCAGAGGGTGTAGCCCAAGTTCAGCCTCTCTCTGTGTCCTCCAGAGAAGAGGGTTCTTTG
CCCTCATCAGGGCCCTGCTTGTGGGTTTTCGGCTCTGGGGAGGAGAGTGTTGGCATCAGT
GTGTTTGGCCTGATTTCTTCAGGGGGCCAAGCTCCCGGGAGGACCCCTAGCCAGGAGGGC
CCCCCATGTCCATCCATCCCTCCTGCTGGGGCTTGGATGTCAGGCTTGGGGGCTGTGAGC
TGGGACCTCGCCTGAGCCCGGTCAGGTGGGACAGGAGCCTGCCAGAAGCCCATGGGGGGC
CAGGCCGGGTGGCTTCTATTTTATTTTTTTAGAGATGGGGTCTTGCTGTGTTGCCCAGGC
TGGTCTCGGACTCCTGGGCTCAAGCAGTCCTCCCTCCTCGGCCTCCCAAAGTTCTGGGGC
TACAGGTGTGAGCCACTTCTGCCCAGCATCCCAGGCCTGAACAGCCTTGGCAGGACCCGT
CCCTAGAGGGGGCTCTGGTGCCTCCCTTAGGTGGGCCTTGAGCTGGTTTTTAACCAAACA
TCCTTCCAAACTCGGGCTGCGACCTGCTTCCTGAGTTTTCTGTATTTCCAAGGAGCCCTC
CGACCAGGGAGAGGCTGGTGGAGTAAGGTCCAGCGGTATTCGGGGGTCCTCTGTCACCTC
GCCCTGAAAACAGCAGCTCCCATCACCTTCACTGGGTCCCGATGGAGCCGTCTCAGAGGC
CGAGGGGCCCTCTGTGTGGGGGTGGGACGCAGGGGCTCTCAGAGCAAGGGCCACAAAGCC
GATGGCACAGATGTGCCCCTGGGCCTGGCCCGTCACCCACATGTGGTGCCCTGGGCCAGG
GCGTGCGGGCGCCAGAGCCTTCCCTACACAGCCTAAGAGCAGGGGCAAGACTCGGCCCCT
CACTCACCCTGGGAGGCCTGCCTGGGCTACATGGACACCTGGGTCTCTTTCTACCCCCAT
TCACCATGGACCAGGGGCCTCCATTTCCTGGGGGCTCTTGCGGCATGTGATTTGGGGGTC
CCTGGGACATTCTCCCGTCAGCTCCACCTGAGCCAAGTGTCCTGTTCCCTGCGGCCCTTG
GCCTTCCAGGGTCCTGGCCAGGCAGGGGTCAGGCACCCCATACTCTTCCGTGTGGCACAG
GTGTCCACCCACCCCCACTGGCCACAGACACCATTCTCCCCCTGGGAGCAGGAGGTGGAG
TAAGTTGTACCCCCAGGCCTGGGTGCTGGGGAGTTCCTGAGGGCATGGGTGGGGCAGGAG
TGAGTGCCTCGTGATCCCAGCCTCAGTTTCTCTCTTGTCACTTTCTCAAACCTGCAGGTC
TCAGGGCCCCGGGCTCCTCCTGGGCAGGATGGGGGGCAGGGGCTGGGCCTTGGGGTGGTG
CTGGCTCTGATGATTCCAGAGCCTGTATCCACCTTCTGGGCTCCTGGCCAGCACCCCACC
CCCAGGAGCCAGGGACAGGTGGCATGTGTTGGGGTCGGGGGATGGCCCCCATCTCGAAGT
GTTCTGGAATTTGGGGGCAACCCTTGCCCAGCCCAGCCATCAAGAACTTCTGATCTCCTG
CCCACCAGGAGGGGACTTAGCCATGGACTTGGCCAGTAGGCCTGGGGAGGGAGGGCTTTG
GCAGCCAAAGTCCACTGGCCCTGCCGTGCCCCTGAGTAGGAAACTGTCCCCTAGGGGCTG
GGTGGCCCCACTGATATATGCAAACCCGCCGGTCCGAGCCCTGTTCCTGCCTGTGCTCCT
CTGTGCCCAGGCTGGCTCTCCCCCAACCCTAGCATGTATACTCTGCCACGGACGTCCCGT
GGGCCATGATTGTGGGCGGCCGCAGCGGGCGGGGGCAGGCGGCTCAGGGCACACTCGGCC
GTCCCTGCCCCATCCTCTGGCAGGGCTGCTTTTGTCTTTGTACCTTTGCATCCTTTGTAA
TGAAACGTAATAAAAATCCAACGTTTTCGTCAAAAAAAAAAAAAAAAAA

Protein Sequence

>23373 : length: 650
MATSNNPRKFSEKIALHNQKQAEETAAFEEVMKDLSLTRAARLQLQKSQYLQLGPSRGQY
YGGSLPNVNQIGSGTMDLPFQPSGFLGEALAAAPVSLTPFQSSGLDTSRTTRHHGLVDRV
YRERGRLGSPHRRPLSVDKHGRQADSCPYGTMYLSPPADTSWRRTNSDSALHQSTMTPTQ
PESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTGSRPKSCEVPGINIF
PSADQENTTALIPATHNTGGSLPDLTNIHFPSPLPTPLDPEEPTFPALSSSSSTGNLAAN
LTHLGIGGAGQGMSTPGSSPQHRPAGVSPLSLSTEARRQQASPTLSPLSPITQAVAMDAL
SLEQQLPYAFFTQAGSQQPPPQPQPPPPPPPASQQPPPPPPPQAPVRLPPGGPLLPSASL
TRGPQPPPLAVTVPSSLPQSPPENPGQPSMGIDIASAPALQQYRTSAGSPANQSPTSPVS
NQGFSPGSSPQHTSTLGSVFGDAYYEQQMAARQANALSHQLEQFNMMENAISSSSLYSPG
STLNYSQAAMMGLTGSHGSLPDSQQLGYASHSGIPNIILTVTGESPPSLSKELTSSLAGV
GDVSFDSDSQFPLDELKIDPLTLDGLHMLNDPDMVLADPATEDTFRMDRL