ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

23326

Name

USP22

Synonym

USP3L;ubiquitin specific peptidase 22;USP22;ubiquitin specific peptidase 22

Definition

deubiquitinating enzyme 22|ubiquitin carboxyl-terminal hydrolase 22|ubiquitin specific protease 22|ubiquitin thioesterase 22|ubiquitin thiolesterase 22|ubiquitin-specific processing protease 22|ubiquitin-specific-processing protease 22

Position

17p11.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

23326

Links to epithelial mesenchymal transition gene database

23326

Links to ovarian cancer gene database

23326

Links to endometrial cancer gene database

23326

Links to iHOP

23326

Sequence Information

Nucleotide Sequence

>23326 : length: 5220
GCAGCCGCAGCTCGGGGGCGGTGCCTGCCTTGCAGCCTCCCCTCGGCGATCGCGCAGCCC
CATCTTTGTCCGGCCTCCGCGCTTTGTTCTCGGCGCCCGGGCCTTGGCCAGCCTGGCCAG
CCGCCGAGCAGCCCCCACGCCGCGCTGGCGTCGTCCTCGCCTCCCTCGCCGCCGCCCCCC
GCGCGCGGCCGGGCCTTGCCCCCCATGGTGTCCCGGCCAGAGCCCGAGGGCGAGGCCATG
GACGCCGAGCTGGCGGTAGCGCCGCCGGGCTGCTCGCACCTGGGCAGCTTCAAGGTGGAC
AACTGGAAGCAGAACCTGCGGGCCATCTACCAGTGCTTCGTGTGGAGCGGCACGGCTGAG
GCCCGCAAGCGCAAGGCCAAGTCCTGTATCTGCCATGTCTGTGGCGTCCACCTCAACAGG
CTGCATTCCTGCCTCTACTGTGTCTTCTTCGGCTGTTTCACAAAGAAGCATATTCACGAG
CATGCGAAGGCGAAGCGGCACAACCTGGCCATTGATCTGATGTACGGAGGCATCTACTGT
TTTCTGTGCCAGGACTACATCTATGACAAAGACATGGAAATAATCGCCAAGGAGGAGCAG
CGAAAAGCTTGGAAAATGCAAGGCGTTGGAGAGAAGTTTTCAACTTGGGAACCAACCAAA
CGGGAGCTTGAACTGCTGAAGCACAACCCGAAAAGGAGAAAGATCACCTCGAACTGCACC
ATAGGTCTGCGTGGGCTGATCAACCTTGGGAACACATGCTTCATGAACTGCATCGTGCAG
GCCCTGACCCACACGCCACTTCTGCGGGACTTCTTCCTGTCTGACAGGCACCGCTGTGAG
ATGCAGAGCCCCAGCTCCTGTCTGGTCTGTGAGATGTCCTCACTGTTTCAGGAGTTTTAC
TCTGGACACCGGTCCCCTCACATCCCGTATAAGTTGCTGCACCTGGTGTGGACCCACGCG
AGGCACCTAGCAGGCTACGAGCAGCAGGACGCCCACGAGTTCCTCATCGCGGCCCTGGAC
GTGCTCCACCGACACTGCAAAGGTGATGACAATGGGAAGAAGGCCAACAACCCCAACCAC
TGCAACTGCATCATAGACCAGATCTTCACAGGCGGGTTGCAGTCAGACGTCACCTGCCAA
GTCTGCCATGGAGTCTCCACCACCATCGACCCCTTCTGGGACATCAGCTTGGATCTCCCC
GGCTCTTCCACCCCATTCTGGCCCCTGAGCCCAGGGAGCGAGGGCAACGTGGTAAACGGG
GAAAGCCACGTGTCGGGAACCACCACGCTCACGGACTGCCTGCGACGATTCACCAGACCA
GAGCACTTGGGCAGCAGCGCCAAGATCAAGTGCAGCGGTTGCCATAGCTACCAGGAGTCC
ACAAAGCAGCTCACTATGAAGAAACTGCCCATCGTAGCCTGTTTTCATCTCAAACGATTT
GAACACTCAGCCAAGCTGCGGCGGAAGATCACCACGTATGTGTCCTTCCCCCTGGAGCTG
GACATGACCCCTTTCATGGCCTCCAGCAAAGAGAGCAGGATGAATGGACAGTACCAGCAG
CCCACGGACAGTCTCAACAATGACAACAAGTATTCCCTGTTTGCTGTTGTTAACCATCAA
GGGACCTTGGAGAGTGGCCACTACACCAGCTTTATCCGGCAGCACAAAGACCAGTGGTTC
AAGTGTGACGATGCCATCATCACCAAGGCCAGCATCAAGGACGTCCTGGACAGCGAAGGG
TACTTGCTGTTCTATCACAAACAGTTCCTGGAATACGAGTAGCCTTATCTGCAGCTGGTC
AGAAAAACAAAGGCAATGCATTGGCAAGCCTCACAAAGTGATCCTCCCTGGCCCCCCCCT
CCCCCAAGTCTCCCGCCGCCTCCCCGGCCTGGTGACACCACCTCCCATGCAGATGTGGCC
CCTCTGCACCTGGGACCCATCGGGTCGGGATGGACCACACGGACGGGGAGGCTCCTGGAG
CTGCTTTGAAGATGGATGAGATGAGGGGTGTGCTCTGGGTGGGAGGAGCAGCGTACACCC
GTCACCAGAACATCTCTTGTGTCATGACATGGGGGTGCAACGGGGGCCTCACAGCACAGA
GTGACCGCTGCCTGGCGTTCCCCAGCACTCGGTGTGGAAAGGCCCCTACCTGCTGTAAGA
TTATGGGTCCATGAAAGCAGTAAGCTGGACACAGAGGTGTAGTGTGCGGGACAGAGGGCC
TTGCAGATGCCTTTCTGTTGGTGTTTTAGTGTTAAAATACGGAGAGTATGGAACTCTTCA
CCTCCATTTTCTCAGCGGCTGTGAAGCAGCCTCCTAGCTTCGGAAGTACGGACACTACGT
CGCGTTTTCAAGCGTGTCTGTTCTGCAGGTAACAGCATCAAGCTGCACGTGGAAGCATCT
CGCGGTTTTCTAGAAACAGGCATTTTCTTATCCCTCTCCCGCTCCTTTTTCCACAAAGGT
GAATTTCATAAATGTAATACTAGTAAAGTGAATGAATTACTGAGTTTATACAGAAATTTA
GGTAACTTCTCCTTTAGTCTCAAGAGCGAGTCTTGCTTTTTAATGGGTGCCGTTTATGTT
GCTGCCCGCCCTGTGTGCCTGGCTCCTCTGGGTGCCTTGGTGTCTGCTGGTGGCTGGCAG
TGGGCGCAGCGGAGGAGAGTTGTGCTGCAGCTCATACGGTGTGTCTGTCATCTCAGTCTG
GAGTAAATGCAGTGTCTGCCGGTGTCTGATGGGTTCTGTCCCTCGTATTTTCTTTGCCTT
CTATCCCATTGCCTGGCTACCGCTGCCTGGCAGCCAAGGGTGTTGGTCGCGAAGCTGGAG
TGGCCTCTGGTGGAGCCTGCATCTTGTCTCGTCTGCCTCTGCTTTACATTTGGTGTACTT
TCGGGCGTGGTGGCAGTAAAATGACACCGTGATTGAGCTTGTCAGCAGAGCTGAAAGAGA
AAGTAGAAGGATGTGCATTGTTTCTTGTAAGATATCTTGCATGTATCTGTGTATTCAAAT
TCAAACAGAGATGGTTTGTCCATTTGTCCACTGAGAAATTAGAAACTAGGGACAAGGGGG
AGGAAAAGTACTGAAATACAGTTTATGAAGCAAGTGTGTCTCGGGCTGTGCTTGTCCCAG
GAGCCCCAGCAGCATCTGAACTGAGGCTTCTTCAGTCCTGCAGGAACAGGATCATCTGTC
TCAGCGGTGGGCAGATGTTTTCATAGACAGCCAGGGAGTAAACACTGTTGGCTCTGTGGG
CTGTATGGTCTCTGCCATAAATAGTACAGAGATGTGGCTGTGTCTAGTACAACTTTTAGA
CACAGAAATCTGAATGACATATATTGTTCTGTGTCAAGAAACTTAGATTTTTTTTTTAAC
TATTTAAAAACGTGAAACCTATTCTTAGCTCACAGGCCATGGAGAAGCTGGTGGGGACCA
GACCCAGCTCCTTAGCTGGCTGGGCTGGGGAGGGGGTAGTGACAGTGGCAGCTGCTACTC
ACTGCTCAGTGTGGAAAACACAGGACTTGGCAATCACAGCCCGCAGAACCATCATGTGTG
GCAGAAGCCTGAGGGATGCGGTTTCTTGCCCACGTGCTCTGTTCATTTTCTGTTGTTTTT
CTGCACTTAAAGAATTCACATGGAAGCATGTTTTATAAAATGAATTACCAGAGAAACAGA
GATGGGCCGAGATTTTCAGAAATGGTCCCATGTGACCAAGTTCTGCTGTTTGGGTGACAG
TGCTTTGAAGATCTCCTTTGAGGATGTGCAGTCTTTTTTTTTTTTTTTTTGAGATGGAGT
TTGTTGCCCAGGCTGGAGTGAGTGGCACAGTCTCGGCTCACTGCAACCTCCACCTCCTGG
GTTCAAGCAGTTCTCGTGCCGCAGCCTCCCAAGTAGCTGGGACTACAGGCATGCACCACC
ACGCCAGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTCTCAAACTCCT
GACCTCAGGCGATCCACCCACCTCAGCGTCCCAAAGTGCTGGGATTATAGGCGTGAGCCA
CCGCACCTGGCCTATGAGTGGTCTTTTAATTAGGAACAAATCTAATGGAAAGGAGAGTTG
ACTGAAGTTGGCCCACAGGATTGTGAGCTGGGCAGTGCCTTCATGAAGGCTTGCCACCTT
GGGACGCCCCAGTTTACTGGGGTGTCTTGCGGAGTGCAGAAGGCTTTCTGGCAGCTGCCT
GGGTTTGGCCAGACCCTGCCTCCCCTCCCGCCGGCCAACCCCTAGTCCCCTTCCTGTCTC
CACTTGCATTCAGGGGTGGCTGCTGTTCTGAGAACATTAGAACTGGGAAGAGAGATGGAG
TCACATGGATTTTTGGTGGGCATTATTCTAAACTTTCGTATCCAAGTTAGTCCCCCTTAT
TCCACTGTGGCATTGCCGTTCTAAGCAGTTACCTGATGCCTGCTGCTGAAGAGCTGCTCA
CAGGAGGCGGCGGCGGCCCTGGCACTGCCCCTTGCATTAGGTCTTGTGTTTGATGTGTTC
TTGTGAATTTACTTTGTCAGAACAAAATATTTACGCGTTGGGTTCAGGAATTTCTTTTAG
CTCCCCATCTGGCTGTGAAATTCAGGAAACCTCCCGTTGCCTAGTAATCACCCCATGTAG
GTGTACATTGTGACAAAGTGCATCTGACCACTAAGGGGCCCCCTTGGTGACCCCAGCACA
TTCACAGCAGTGTTAAAATGGCCTGCATTTTGGAGATGCTGGCTGGCCTTTCAGTGCCTC
CCAGGAAGACACATGGCCTTTCCCTCTTCAGATGCCTGAAGGGAGTGCTTTGAGGCAGGT
GATGTGCTGGGAGTGTGGGCGGCCTCCCTCTGGCCCCGGGGCCCTCTGTGGACCTTGGCT
CCCTCCGTGGACCTGGGCTTCGTGGTGAGCACTGCAGCCTCCCTGGGCATTCCCTCCAGC
GCCAGCACCACTGCAACATATAGACCTGAGTGCTATTGTATTTTGGCTTGGTGTGTATGC
TCTTCATTGTGTAAAATTGCTGTTCTTTTGACAATTTAAGTGATTGTTTTGTTTACTGTA
AGTTTGAAAATAAAAATGAAGAAAAAAATTCCAATGACTGTGCTGTGGTTGGAGACTTTA
TTTACCAAGATGTTTACTCTTCCTTTCCCCTTCCATTTTGAGGAGCTGTGTCACTCCTCC
TCCCCCCCAGTGCTTTGTAGTCTCTCCTATGTCATAATAAAGCTACATTTTCTCTGAGAA

Protein Sequence

>23326 : length: 525
MVSRPEPEGEAMDAELAVAPPGCSHLGSFKVDNWKQNLRAIYQCFVWSGTAEARKRKAKS
CICHVCGVHLNRLHSCLYCVFFGCFTKKHIHEHAKAKRHNLAIDLMYGGIYCFLCQDYIY
DKDMEIIAKEEQRKAWKMQGVGEKFSTWEPTKRELELLKHNPKRRKITSNCTIGLRGLIN
LGNTCFMNCIVQALTHTPLLRDFFLSDRHRCEMQSPSSCLVCEMSSLFQEFYSGHRSPHI
PYKLLHLVWTHARHLAGYEQQDAHEFLIAALDVLHRHCKGDDNGKKANNPNHCNCIIDQI
FTGGLQSDVTCQVCHGVSTTIDPFWDISLDLPGSSTPFWPLSPGSEGNVVNGESHVSGTT
TLTDCLRRFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRR
KITTYVSFPLELDMTPFMASSKESRMNGQYQQPTDSLNNDNKYSLFAVVNHQGTLESGHY
TSFIRQHKDQWFKCDDAIITKASIKDVLDSEGYLLFYHKQFLEYE