ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

23263

Name

MCF2L

Synonym

ARHGEF14|DBS|OST;MCF.2 cell line derived transforming sequence-like;MCF2L;MCF.2 cell line derived transforming sequence-like

Definition

DBL's big sister|MCF2 transforming sequence-like protein|guanine nucleotide exchange factor DBS

Position

13q34

Gene Type

protein-coding

Pathways and Diseases

Pathway

Regulation of CDC42 activity;PID Curated;200059

Pathway

Signaling by Rho GTPases;Reactome;REACT:11044

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Regulation of RhoA activity;PID Curated;200050

Pathway

Neurotrophic factor-mediated Trk receptor signaling;PID Curated;200128

Pathway

Signalling by NGF;Reactome;REACT:11061

Disease

HEMATOLOGICAL;GAD

Disease

Factor VII;NHGRI

Disease

Factor VII;GAD

External Links

Links to cell senescence gene database

23263

Links to epithelial mesenchymal transition gene database

23263

Links to ovarian cancer gene database

23263

Links to endometrial cancer gene database

23263

Links to iHOP

23263

Sequence Information

Nucleotide Sequence

>23263 : length: 6456
AGGGACATCGAATCGGAGGCCCTGGGAGGAGCAGCCGGCTGGCTGCCCTGCAGAGGCCAG
GTCTGCCCAGCAAACCCAGGAAGGTGTGGCGTCCCCGCTTCGCGGCCAAGATGGTGCTGG
TGCTGCGCCATCCTTTGTGTGCCCGGGAAGGGCGTTCCGGGAGCCGGGTCGGGGGCTCCT
GACTCGCACTGGGCAGCATGACGGTGCGCCGGCTGTCACTGCTGTGCCGGGACCTCTGGG
CGCTGTGGCTGCTGCTGAAGGCCGGCGCAGATGAAATCATGCACCAGGACATCGTCCCGC
TCTGTGCTGCCGACATCCAGGACCAGCTAAAGAAGCGCTTTGCTTACCTGTCCGGTGGGC
GGGGGCAGGACGGAAGCCCGGTTATCACCTTCCCTGACTACCCGGCCTTCAGCGAGATTC
CGGACAAGGAGTTCCAGAATGTCATGACCTACCTCACCAGCATCCCCAGCCTGCAGGACG
CTGGCATCGGATTCATCCTGGTGATAGACCGGCGACGGGACAAATGGACCTCCGTGAAGG
CGTCCGTCCTGCGCATCGCAGCATCTTTCCCGGCAAACCTGCAGCTCGTCCTCGTGCTTC
GCCCGACGGGTTTTTTCCAAAGGACTCTCTCCGACATCGCTTTCAAATTCAATAGAGATG
ACTTTAAGATGAAGGTGCCGGTCATAATGCTGAGCTCCGTACCAGACTTACACGGTTACA
TCGATAAGTCGCAGCTGACCGAGGACCTGGGTGGGACCCTGGACTACTGCCACTCCCGGT
GGCTGTGCCAGCGCACGGCCATCGAAAGTTTCGCCCTCATGGTGAAGCAGACGGCTCAGA
TGCTGCAGTCCTTCGGGACCGAGCTGGCTGAAACAGAGCTGCCCAATGACGTCCAGTCGA
CAAGCTCAGTGCTGTGTGCGCACACAGAGAAGAAGGACAAGGCGAAGGAGGATTTGAGGC
TGGCACTGAAAGAGGGGCACAGTGTCCTGGAGAGCCTCAGGGAGCTGCAGGCTGAGGGCT
CAGAGCCCAGTGTGAACCAGGACCAGCTTGACAACCAGGCCACCGTGCAGAGGCTCCTGG
CCCAGCTGAACGAAACCGAGGCTGCCTTCGATGAGTTCTGGGCAAAGCATCAGCAGAAAC
TGGAGCAGTGTCTGCAGCTCCGGCACTTTGAGCAGGGCTTCCGGGAGGTCAAAGCCATCT
TGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGACATCGGCAACAGCCTGGCGCATG
TGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGA
GGGCCCGGGCCCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAG
ACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTCTGTGACCAGTTCTCTGCGGAGA
TCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGT
CCATGAAGTGGTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCC
AGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATCGAGAAGTTTTTGGAGACCGGTG
CGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACC
AAGATCTCATGGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGT
TCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCCAGGCAGACGCGGCCCGTGCAGC
CGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGC
GAGGCTCTGAGAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGG
CCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGCTCAGCGGGGGAGGAGGAGGAAA
GCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACG
TGGAGGAGCTGCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGG
CTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGATGTTTTGTTTGGAAACATGGAGG
AAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCC
CAGAACTGGTTGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGT
ACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGACAGTGCTCCGACTGCCCGTTTT
TCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGC
CAGTGCAGAGGATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGA
ACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGCTCCATCCTGGGCATCCTGAAGG
CCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACC
TGGGCAAGCTGCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACA
CCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAGCGGCACCTGTTCCTGCACGAGA
AGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCT
CCTACAGCTACAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGG
GAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGCGAGGAGGTCTACATCGTCCAGG
CGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCC
AGCTGCAGGCTTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGC
CCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGAAACTCAAGGAACATCAAGAAGC
TGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGA
CAAAGCCCCCCGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTG
AGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATTAACTCGTCCGACGCAGAGGAGG
ACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACG
AGAAGGGAGGCCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGG
AGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACCACTGGCAAGGAGGGCTGGGTGC
CGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCT
CAGAGTCGAGCCCGGGGTCGGCCGTGCTGAGCAACTCGTCCAGCTGCAGCGAGGGCGGCC
AGGCCCCCTTCTCCGACCTGCAGGGGTAGCGCGGCCTCGGCGCCGGAGACCCGCGCGCTG
TCTGGGGCTGCGGTGGCGTGGGGAGGGCGCGGCCCCCGGACGCCCCGAGGAAGGGGCACC
TCACCGCCCCCACCCAGAGCGCCTGGCCGTGCGGGCTGCAGAGGACCCCTCCGGGGCAGA
GGCAGGTTCCACGGAAGACCCCGGCCCGCTGGGGCTTCCCCGGAGACTCCAGAGCCCACA
GAGGAGGGGCCGCAGGGAACAGCCCCGGGCGGCAGGCGCCGGGCAGCGGCATCTCGTCCT
GGCTCCACCGTGCTGCTTCTGCCTCTGGACGGTGCTTTCAGGGGACGCGCGGACCGTGGT
GGAGCTGCTTCCGGAGAAGTGGAGGATCCTCTGGCCAACGGCCTGAGGAGAGCGGGGCAC
GGGGTCTCTTTAGCTTTTACAAGTTTTAGGATTTTTTCAAGCAGGGATCAATCCCGTGGC
CATTTTTTGTGGTACTTTGGCCTCAATTCTTCACCAGGAATCACTGTGTTTACATGAAAT
GACAATTTGATACTGTATTTGATAGAAAACTATTTTTTTGTTACCGGGGTTTACATAGAA
GCACGTTGTTTATACCACTAAGTGACTTTGGGGGGGCTCTCCCATGGAAACGGATGGCAC
TCCCTGAAGCTCCCTGGTCACAGGTGGATGAAAACGTGTCCGTGGGTGACATCAGGTGGT
GTCTCCACCACCAAAAGCAGTTAGAAGCCAAGGAGATTCCTTTATCTACCTAGGGTTCAT
TTTCAAAAGAAAATTTAAACTATAATTTAAACAATTAACGTTCTTTTCTACAAAAAAAAT
GCAGGGACTTGATTTTTTTAAAGAGCTTCACTGAATTAGGATATTTTTATTGCTTTTAAA
GAAAATACAAAGATGCAGTTTCTGCAGGGTGTGGCGTGGACCAGTGCTGCCGACCATAGC
TCAGAGAGCCCTGCCCCTGCCTCACTGCACTGCAGCCTCCTCGGAGGCCGCACCTCCACT
CCACTCCCCACGCGCCCCCTGCCTCCCACCCAGGTCCACCTGCCACCTGGTGACCACCTT
GAGTACAGAAGTGAAAGTGGGGAGAGTATTTTATTCAAGTCACAGCAGAACTGGAAAAAA
ACTCTTCTGTTTTACCAACTTCTTGTGTTTCAGAAACATATTCTGTTCAAAACTTTTGAA
GCCCTTTCGGTGTCTAGTCTGCAGATGTTTTTGTATGTGTGCACCTCTGACCATGTGTGT
ACATATGTGTCTTGCTGGAAAGGACATATTCGCTGTCCCCGTGCTGCTGGGAGGGCCGCC
TCACAGCCTCACGGTTCCCAGCCCCAGCACAGTGGAGGCAGGCGTGGCTGCATTCCCCTC
ACGCTACCCTCCCAGCGGCTTGTAGCCGTCACTGGCCAGACCTCCAGGGTGCGGAATCAA
ATAGGAAGCATGCAGAGACTCGGCAGCTTTTCCTCTGATGTGTAAGTTATTTGGAACGCG
TGCTGTGTCCCGCGATGTCCCTGATGTACTGTGCAGGCGCGGTGCCTCCGTCTCGTCGCA
CAGCTGCGCGCCCTTGTGTGACCCTCCCCATAAAGGCACTTTACAGCTTCATGTTTCATC
CACTGTCACTTTTTTTTAACTGCTGATGTAAATGGAATTTTAAAAGCAGAGTTCTTTATT
GTATGGATGACGTTTGAATAAATATCAGCAACTCCTGCCATCTGCCTTTGTCTGTCAAGA
CACAGAACGTCTCAGCAGTCGGGGTTTCCAGGGCCGCAGTGCACTGTGCTTGCACATGGT
AAGTCATTGTTGGGACGGAAAAGAAGCCGGCAGTGGGCAGGGCCCAGCGTGCGGCTCAGG
CACCGAGCAACCGCTTTGCTTTCTTCTGTCAGACGGCGATGATGACAAAATAGCAACAAG
GTTGTGCGTGTCAGAAACGCAAAGGCAGCAGAGGAAGCGTAGTGGAACCATTACAGAATC
ACAATGCAGCCGACACTCTCCAGACCAGAAAAGGGAGCATAAAGAAAGGGTATTGATCCA
ATAGAAGAAGGGAAGGGTGGAGAAAGGGGAAAGCATGGTTAACAGGAAACAACATGTAAC
GGAAGAGACAGCCCAGATGTGTCTGGCTCACAACAGACGTGATCATGTTATGCTGGCCTG
GAAGAGCATCGGATCAGACGTGACAAGTCACTGCTTAGAGACCATCAAGCAAATTTATAT
ATAGATTGGAGATTTAAAATAAAAGAAGACAGAACAGACAAACACCATAAGAAAGCTGGT
GTAGCAGTATCGATGACCTGAAATGGGATTCAGGACAGTTCATAGAGTAAAGGGGGCTGC
GTGGCAATCAGGAACTCATAAGCCACTGACTATAAAGCTCAAAACACAGCAAAGTTGGCA
GTCGGCAGACAGCAATGTTGACTGTCATGAAAAGTGATCCCTGTTTGCCCCTAAACGTAG
AGAAATCTGCGTTATTTTCCAGCACACATGGAGCACAAACAAAATATTTGCAAAACAATG
GGAAGATCATTGAAACACTGTTTGGCAATTTAAAAGCTTGTTTCTAACTCACGGGATGCG
GGCAGTCTGCTCTCTAGAACTGGACAGCGTGCACAGAGCCACGGGAGGGAGCAGCCACGG
CCAGCTCAGATTGGTGTCGACAGCTTAGTGGTGTCTGATTTTATACATGACAAAATGAAC
GAGTTAACCATTTAAGCCAAAAAAATAAGACTAGCGTAACCCAAAGAAAGTATTTAAATA
CTTCTGTCAATTAGGACAGTTGAGAAAAGAGAATAACAAAATCAAAAGCAAAACTCAAAC
TTTGTACCTGAAAAATCTAATAAAACTGACTAATTTATAGAAAACCTAAGAAACTCCATA
TCAAATAAAAAATTTTAAATATGAGAGAAAAAAAAA

Protein Sequence

>23263 : length: 1211
MFDCWRFILCKRPGSNSYSSPQRPNEAKKEETDHQIDVSDVIRLVQDTPEATAMATDEIM
HQDIVPLCAADIQDQLKKRFAYLSGGRGQDGSPVITFPDYPAFSEIPDKEFQNVMTYLTS
IPSLQDAGIGFILVIDRRRDKWTSVKASVLRIAASFPANLQLVLVLRPTGFFQRTLSDIA
FKFNRDDFKMKVPVIMLSSVPDLHGYIDKSQLTEDLGGTLDYCHSRWLCQRTAIESFALM
VKQTAQMLQSFGTELAETELPNDVQSTSSVLCAHTEKKDKAKEDLRLALKEGHSVLESLR
ELQAEGSEPSVNQDQLDNQATVQRLLAQLNETEAAFDEFWAKHQQKLEQCLQLRHFEQGF
REVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIG
NKHYAVDSIRPKCQELRHLCDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLAS
QPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDLMEHVRKVFQKQ
ASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALR
RGPYRRAKSEMSESRQGRGSAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAE
MDNPLMAHLLSTGLHNKKDVLFGNMEEIYHFHNRIFLRELENYTDCPELVGRCFLERMED
FQIYEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKE
MLKYSRNCEGAEDLQEALSSILGILKAVNDSMHLIAITGYDGNLGDLGKLLMQGSFSVWT
DHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGYEKAPSYSYKQSLNMAAVG
ITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRAL
EQSQSLPLPAPTSTSPSRGNSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKDDTVTS
SASESSALSRKRFTLQGFANLKGQKASPTSPDKKAKRHEVKSDPTPFGVRGWSKTSHSLE
APEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKGGPDALRVRSGDVVEL
VQEGDEGLWYVRDPTTGKEGWVPASSLSVRLGPSGSAQCLSSSESSPGSAVLSNSSSCSE
GGQAPFSDLQG