ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

23259

Name

DDHD2

Synonym

SAMWD1|SPG54|iPLA(1)gamma;DDHD domain containing 2;DDHD2;DDHD domain containing 2

Definition

PA-PLA1 like|SAM, WWE and DDHD domain-containing protein 1|intracellular phospholipase A1gamma|phospholipase DDHD2|sec23p-interacting protein p125-like phosphatidic acid-preferring phospholipase A1

Position

8p11.23

Gene Type

protein-coding

External Links

Links to cell senescence gene database

23259

Links to epithelial mesenchymal transition gene database

23259

Links to ovarian cancer gene database

23259

Links to endometrial cancer gene database

23259

Links to iHOP

23259

Sequence Information

Nucleotide Sequence

>23259 : length: 5054
ATTCCGACTTTCCCGCCCCGTACGTGAGGGGCCGCCTTGAAGCCTCTTCCGCCACGGACA
CTCGAAACTGATCTTGAAGCCCCTGCCGTCACGGATACTAGAAACTGATCTCGAAGCCCC
TTCCGCCACGGACACTCGAAACTCTCCCCCACTGTTAGACCTCAGCAGCCAGCAGCCCGC
CGCCCGGCGCTGCAGCTCCCTGCCCGCAGGAGCCACGTCTCGCGCGACTCCCCCCACCTC
TCGCGACACTTGCCGCCCGTGCCCTGCGGCCCTGCACGCCCCACCCGCGGTCGCGCGCCG
CGCTCCCCGCCGCCTCACCTTTTCGCCTGGCATCCGGGCCCGCTACTCGCCCACTGGGAG
CGCCGTGGCGCCTGGTGTTCGGCGCGAGCCCGGCGGGGCTGCAGGTTCCGCCCTGCTCCG
CCGCGCCCCGCCCGGGCTGGGGTAAAGGCCGCGGCCGGGCCATGCAGTGTCCTCCTCAGG
GAGGGCAGGAGAGCCTGAGGAGTGGCGGGGCCGCCAGAGAGCGAAATGTCATCAGTGCAG
TCACAACAGGAGCAGTTGTCCCAGTCAGATCCATCTCCGTCACCAAACTCATGTAGTTCC
TTTGAGCTAATAGACATGGATGCTGGCAGCTTGTATGAACCAGTTTCTCCCCATTGGTTT
TATTGTAAGATAATAGATTCTAAGGAGACATGGATTCCTTTCAACTCTGAGGATTCACAG
CAGCTGGAAGAGGCATATAGCTCTGGAAAAGGTTGTAATGGGAGAGTTGTTCCTACTGAT
GGGGGCAGATATGATGTTCATTTGGGGGAGAGGATGCGGTATGCTGTATACTGGGATGAA
CTGGCATCGGAAGTGAGACGATGTACGTGGTTTTACAAGGGGGACAAAGACAATAAGTAT
GTTCCCTACTCGGAGAGCTTCAGCCAAGTTTTAGAGGAAACTTACATGCTTGCTGTAACT
TTGGATGAATGGAAAAAGAAACTGGAATCTCCCAACAGAGAAATTATTATTTTACACAAT
CCAAAGCTTATGGTGCATTACCAGCCAGTTGCAGGGTCTGATGATTGGGGTTCAACACCC
ACGGAGCAGGGTCGACCAAGAACTGTGAAGAGAGGAGTTGAGAACATCTCTGTTGACATT
CATTGTGGAGAACCTTTACAAATAGATCACTTGGTTTTTGTAGTCCATGGGATTGGACCA
GCTTGTGATCTCCGCTTTCGAAGCATTGTACAGTGTGTTAATGATTTTCGCAGTGTTTCC
TTGAACTTGCTACAGACACATTTTAAGAAAGCCCAAGAAAATCAGCAGATTGGGAGGGTA
GAATTTCTTCCAGTCAACTGGCACAGTCCTTTGCATTCTACTGGTGTGGATGTAGATCTG
CAGCGAATAACCCTGCCCAGCATTAACCGCCTCAGGCACTTCACCAATGACACAATTCTG
GATGTCTTCTTCTACAATAGTCCCACCTACTGTCAGACTATTGTGGACACAGTTGCTTCT
GAAATGAACCGAATATACACACTTTTTCTACAGAGGAACCCTGATTTCAAAGGGGGTGTA
TCCATTGCTGGTCATAGTTTAGGTTCGCTTATATTGTTTGATATCCTAACAAATCAGAAA
GATTCTTTGGGGGATATTGACAGTGAAAAGGATTCGCTAAATATTGTAATGGATCAAGGA
GATACACCTACACTAGAGGAAGATTTGAAGAAACTTCAGCTCTCTGAATTCTTTGATATC
TTTGAGAAGGAGAAAGTAGATAAGGAAGCTCTGGCTTTATGTACAGACCGAGATCTTCAG
GAAATAGGAATTCCTTTAGGACCAAGAAAGAAGATATTAAACTATTTCAGCACCAGAAAA
AACTCAATGGGTATTAAGAGACCAGCCCCGCAGCCTGCTTCAGGGGCAAACATCCCCAAA
GAATCTGAGTTCTGCAGTAGCAGTAATACTAGAAATGGTGACTATCTGGATGTTGGCATT
GGGCAGGTGTCTGTGAAATACCCCCGGCTCATCTATAAACCAGAGATATTCTTTGCCTTT
GGATCTCCCATTGGAATGTTCCTTACTGTCCGAGGACTAAAAAGAATTGATCCCAACTAC
AGATTTCCAACGTGCAAAGGTTTCTTCAATATTTATCACCCTTTTGATCCTGTGGCCTAT
AGGATTGAACCAATGGTGGTCCCAGGAGTGGAATTTGAGCCAATGCTGATCCCACATCAT
AAAGGCAGGAAGCGGATGCACTTAGAACTGAGAGAGGGCTTGACCAGGATGAGTATGGAC
CTTAAGAACAACTTGCTAGGTTCGCTGCGGATGGCCTGGAAGTCTTTTACCAGAGCTCCA
TACCCTGCCTTACAAGCTTCAGAAACACCAGAAGAAACTGAAGCAGAACCTGAATCAACT
TCAGAGAAGCCTAGTGATGTTAACACAGAAGAGACCTCTGTGGCAGTTAAAGAAGAAGTC
CTGCCTATCAATGTGGGGATGCTGAATGGAGGCCAACGCATTGACTATGTGCTACAGGAG
AAGCCTATTGAAAGTTTTAATGAGTATTTATTTGCTTTACAAAGCCATCTATGCTACTGG
GAGTCTGAAGATACAGTATTGCTCGTCCTCAAAGAGATCTACCAAACCCAGGGTATCTTC
CTTGATCAGCCTTTACAGTAAAAATGACCCATCTATGGCTGCTTAATGGCAAACAGCAAA
TGACACTGCAGCTTCAGGAGGTGCTCAAGAGGACACTGACCGACTGCTGTGGCCGTTGGT
GGGAAATGCTGTTCAGGCAGAAAAGAGCCCAGGTGTCACCTGGAGGACTGAGCCTACTGA
AGGACAGGCAATTCTCATCCCCCTCCCGCTTCATACATACGTGCCACAAGCACCCAAACT
TGTCACTTATGCAATGGACTGACCAAAACAAAACAAAAAACAGAAATGTTTTTTGAAAGA
CACGGATTACCCACATTTTGGGAGTGTAACGTAAGTGCAATTTTTTGTTTTGTTTTTTTC
CCTACATAGACATAGTAAAAGGAAAGAAGATGTGCTTGGGGAGAGGGTTGACAAAATGAC
AAAATAAAGAATGTACATAAAAAGTATTTGTAAAAATGCTGGTATCTCATGCAGGAGTCT
CTTCCTCAAATGTGTTCAATCAATCTGAGCTATCTACTGTGAACACTCTCCCATTTGCAG
AACTTCACCTTTAATCCACGCTAAAGAGGATAAGAGACTAGGCTATTTATTTTCAAAACA
GTTTACAAAACAATGCTTTCTACTTCATAAATGTAAAAAGAAACTAAAATAAGGAGAATC
TGAAGAGTTTCAAGTACTTAAAAAACCTGAATTCAATGAGGCAGAGGTCTCAATGTTAAA
GTGACTATTTCGTACCTGTGGTAAACATTATCCCCCCCCTTACCCTTTACCAGGAGAAAG
GGGGTTCCCTTTCTCCTGGTACCCCACCCCAGGTAAAAGTTGGTGAGATTTCAGTATATA
CACATTTCCAACTTTTCAGTATTTGTTAATTCATTGCAAAGCTGTCTAATTATAGTATTC
CCTAGTCCATCTGAAAATGGAAGCAAGTTCTACTTTTTGTTTTACAAATAACCAGAGACC
AATTCTAGGTGGCCCTAGGCCAAAGGAAAGTGTTTCCATTCATCAATTCATGTCTGCACC
AACTTGGACAACTGGGGGAGGCTGGATGCATCAGCCTTGTGAAAAGTAACTTTAGTCTAC
GCTGCCCAGAAATAAAGCAACTTTCCAATGTCCTTTTTCTCATATGGAAGTATAGAATGT
CAGCTTCCCAGCTGTGAGGGCTCCATAGCCACTGTTTTCTTATCTTGTTAAGAGGACATG
GCATGTGGCAGCCAACACCTTGACTTCAAGGTGAATGCTAAAGGAAGAGCTTTGTATTTA
AAATGAAATGAAAGACAAGCAACAAGTCCTGGGCAGTCCAGAGATTGTATTCTCTACAGA
TGGCCTGTTTGCAAACAGTAGGTCTGGGTTTGACCTATTGGAATACACCATGCAAGAAAC
TACTCAAAAAGGAAATTCCACTTCATGAACCAGGAAAGTTGTCCAATAGCCTGTCCCATC
TGAGGGTCCTTTACATGATTAGATACTCAATATCTCAGTTCCACAACGTTATTTACAGAC
ATGTTTTCAAATATTTTGTGTAAATGGCAGAAGGGAGCTGGGAGCAGTCCCCCTGCCTCC
ATTACTTTTTTAGCTTTCACATATGTTCTTGACTTGTACAGAAAATCCCAAATTTTAAAT
GATTCCCCAACTCAGCCAGTTCTATAGATGAGGCCAGATCATTTTTGAGAATTAAGATAA
GAGTGGGAACTTGTTAAAACAAAAATGAAAATAAAACCCACCTCACTCCTGTATCTCTCC
CTGATTAGACATTAAAGAGGTGAATCACTGCCTCTGGCTGCTTCAGCCTTCCAGGAATGA
AGAGCCATCCACCTTGCCCTTCTCAGCCAGCCACAGGCAGCTCTTCTGATTCTTCCCTCG
CAGCAGTGGCGGTCCAGCCCCTCCCTCCCCTGCACAGTGCCTGAGAAAGTTTCCCAGGAT
TTCATCTTTAGCTCTTACTGATCCAGTTTCTGAAGCTTTAGGCTGATTATCAAAAATCTT
ATGTTCACTTCTTCCTTCAACAAATTAACATGTGGTTAAAAAAAATACCACCATTAGCCC
ATGCTGCTTTAAGTTATTTCATTGTTGGACAAGAATAAAAACCAGCCACTTACACTCTGA
CCACATATAGATTTAAAAGTTAACAAATACCAACTTCAGACTATGAGTGAGCAATGTCTT
TTGGAATATTTCATTGGTGTATCACAGGCACAGTGCATGTATACTCATGCACACATAAAG
GACAATTTTCTCTTTCTGCATCTATAATCTGCAACTTAAAAATATATCAAATAGGTCAAC
ATTGACGCTATGGAGGTGTGAGGAGAACTCCTTGGCACCAGCATGACTAAAACCGCTTTT
TAGACCATTAAAGAACATTCATGGCCAAAGACTTCAGAACTATGGTTACCTTTTTTTTTT
GAGATGGAGTCTCG

Protein Sequence

>23259 : length: 711
MSSVQSQQEQLSQSDPSPSPNSCSSFELIDMDAGSLYEPVSPHWFYCKIIDSKETWIPFN
SEDSQQLEEAYSSGKGCNGRVVPTDGGRYDVHLGERMRYAVYWDELASEVRRCTWFYKGD
KDNKYVPYSESFSQVLEETYMLAVTLDEWKKKLESPNREIIILHNPKLMVHYQPVAGSDD
WGSTPTEQGRPRTVKRGVENISVDIHCGEPLQIDHLVFVVHGIGPACDLRFRSIVQCVND
FRSVSLNLLQTHFKKAQENQQIGRVEFLPVNWHSPLHSTGVDVDLQRITLPSINRLRHFT
NDTILDVFFYNSPTYCQTIVDTVASEMNRIYTLFLQRNPDFKGGVSIAGHSLGSLILFDI
LTNQKDSLGDIDSEKDSLNIVMDQGDTPTLEEDLKKLQLSEFFDIFEKEKVDKEALALCT
DRDLQEIGIPLGPRKKILNYFSTRKNSMGIKRPAPQPASGANIPKESEFCSSSNTRNGDY
LDVGIGQVSVKYPRLIYKPEIFFAFGSPIGMFLTVRGLKRIDPNYRFPTCKGFFNIYHPF
DPVAYRIEPMVVPGVEFEPMLIPHHKGRKRMHLELREGLTRMSMDLKNNLLGSLRMAWKS
FTRAPYPALQASETPEETEAEPESTSEKPSDVNTEETSVAVKEEVLPINVGMLNGGQRID
YVLQEKPIESFNEYLFALQSHLCYWESEDTVLLVLKEIYQTQGIFLDQPLQ