ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2322

Name

FLT3

Synonym

CD135|FLK-2|FLK2|STK1;fms-related tyrosine kinase 3;FLT3;fms-related tyrosine kinase 3

Definition

CD135 antigen|FL cytokine receptor|fetal liver kinase 2|fms-like tyrosine kinase 3|growth factor receptor tyrosine kinase type III|receptor-type tyrosine-protein kinase FLT3|stem cell tyrosine kinase 1

Position

13q12

Gene Type

protein-coding

Pathways and Diseases

Pathway

Hematopoietic cell lineage;KEGG PATHWAY;hsa04640

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Acute myeloid leukemia;KEGG PATHWAY;hsa05221

Disease

Cancers;KEGG DISEASE

Disease

leukemia;GAD

Disease

Leukemia, acute lymphoblastic;OMIM

Disease

Acute myeloid leukemia (AML);KEGG DISEASE;H00003

Disease

Leukemia, acute myeloid;OMIM

Disease

Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE

Disease

Osteoporosis;GAD

Disease

Translocation, Genetic;GAD

Disease

CANCER;GAD

Disease

leukemia, myeloid;GAD

Disease

METABOLIC;GAD

Disease

Leukemia, acute myeloid, reduced survival in;OMIM

Disease

Leukemia, Myeloid, Acute;GAD

External Links

Links to cell senescence gene database

2322

Links to epithelial mesenchymal transition gene database

2322

Links to ovarian cancer gene database

2322

Links to endometrial cancer gene database

2322

Links to iHOP

2322

Sequence Information

Nucleotide Sequence

>2322 : length: 3980
ACCTGCAGCGCGAGGCGCGCCGCTCCAGGCGGCATCGCAGGGCTGGGCCGGCGCGGCCTG
GGGACCCCGGGCTCCGGAGGCCATGCCGGCGTTGGCGCGCGACGGCGGCCAGCTGCCGCT
GCTCGTTGTTTTTTCTGCAATGATATTTGGGACTATTACAAATCAAGATCTGCCTGTGAT
CAAGTGTGTTTTAATCAATCATAAGAACAATGATTCATCAGTGGGGAAGTCATCATCATA
TCCCATGGTATCAGAATCCCCGGAAGACCTCGGGTGTGCGTTGAGACCCCAGAGCTCAGG
GACAGTGTACGAAGCTGCCGCTGTGGAAGTGGATGTATCTGCTTCCATCACACTGCAAGT
GCTGGTCGACGCCCCAGGGAACATTTCCTGTCTCTGGGTCTTTAAGCACAGCTCCCTGAA
TTGCCAGCCACATTTTGATTTACAAAACAGAGGAGTTGTTTCCATGGTCATTTTGAAAAT
GACAGAAACCCAAGCTGGAGAATACCTACTTTTTATTCAGAGTGAAGCTACCAATTACAC
AATATTGTTTACAGTGAGTATAAGAAATACCCTGCTTTACACATTAAGAAGACCTTACTT
TAGAAAAATGGAAAACCAGGACGCCCTGGTCTGCATATCTGAGAGCGTTCCAGAGCCGAT
CGTGGAATGGGTGCTTTGCGATTCACAGGGGGAAAGCTGTAAAGAAGAAAGTCCAGCTGT
TGTTAAAAAGGAGGAAAAAGTGCTTCATGAATTATTTGGGACGGACATAAGGTGCTGTGC
CAGAAATGAACTGGGCAGGGAATGCACCAGGCTGTTCACAATAGATCTAAATCAAACTCC
TCAGACCACATTGCCACAATTATTTCTTAAAGTAGGGGAACCCTTATGGATAAGGTGCAA
AGCTGTTCATGTGAACCATGGATTCGGGCTCACCTGGGAATTAGAAAACAAAGCACTCGA
GGAGGGCAACTACTTTGAGATGAGTACCTATTCAACAAACAGAACTATGATACGGATTCT
GTTTGCTTTTGTATCATCAGTGGCAAGAAACGACACCGGATACTACACTTGTTCCTCTTC
AAAGCATCCCAGTCAATCAGCTTTGGTTACCATCGTAGAAAAGGGATTTATAAATGCTAC
CAATTCAAGTGAAGATTATGAAATTGACCAATATGAAGAGTTTTGTTTTTCTGTCAGGTT
TAAAGCCTACCCACAAATCAGATGTACGTGGACCTTCTCTCGAAAATCATTTCCTTGTGA
GCAAAAGGGTCTTGATAACGGATACAGCATATCCAAGTTTTGCAATCATAAGCACCAGCC
AGGAGAATATATATTCCATGCAGAAAATGATGATGCCCAATTTACCAAAATGTTCACGCT
GAATATAAGAAGGAAACCTCAAGTGCTCGCAGAAGCATCGGCAAGTCAGGCGTCCTGTTT
CTCGGATGGATACCCATTACCATCTTGGACCTGGAAGAAGTGTTCAGACAAGTCTCCCAA
CTGCACAGAAGAGATCACAGAAGGAGTCTGGAATAGAAAGGCTAACAGAAAAGTGTTTGG
ACAGTGGGTGTCGAGCAGTACTCTAAACATGAGTGAAGCCATAAAAGGGTTCCTGGTCAA
GTGCTGTGCATACAATTCCCTTGGCACATCTTGTGAGACGATCCTTTTAAACTCTCCAGG
CCCCTTCCCTTTCATCCAAGACAACATCTCATTCTATGCAACAATTGGTGTTTGTCTCCT
CTTCATTGTCGTTTTAACCCTGCTAATTTGTCACAAGTACAAAAAGCAATTTAGGTATGA
AAGCCAGCTACAGATGGTACAGGTGACCGGCTCCTCAGATAATGAGTACTTCTACGTTGA
TTTCAGAGAATATGAATATGATCTCAAATGGGAGTTTCCAAGAGAAAATTTAGAGTTTGG
GAAGGTACTAGGATCAGGTGCTTTTGGAAAAGTGATGAACGCAACAGCTTATGGAATTAG
CAAAACAGGAGTCTCAATCCAGGTTGCCGTCAAAATGCTGAAAGAAAAAGCAGACAGCTC
TGAAAGAGAGGCACTCATGTCAGAACTCAAGATGATGACCCAGCTGGGAAGCCACGAGAA
TATTGTGAACCTGCTGGGGGCGTGCACACTGTCAGGACCAATTTACTTGATTTTTGAATA
CTGTTGCTATGGTGATCTTCTCAACTATCTAAGAAGTAAAAGAGAAAAATTTCACAGGAC
TTGGACAGAGATTTTCAAGGAACACAATTTCAGTTTTTACCCCACTTTCCAATCACATCC
AAATTCCAGTAAAAAGAAATGAGCTTTACAAAGGCAAACTGGAAAAAAGAAGGATGGTGA
AACGCTTACGGGACTCTCGGGAAGATCTGTATTATGTGAGGGAAAGTGGGCTGAGTTCAG
AAACCAAAGAATGAGATCGATCATGCCTGGTTCAAGAGAAGTTCAGATACACCCGGACTC
GGATCAAATCTCAGGGCTTCATGGGAATTCATTTCACTCTGAAGATGAAATTGAATATGA
AAACCAAAAAAGGCTGGAAGAAGAGGAGGACTTGAATGTGCTTACATTTGAAGATCTTCT
TTGCTTTGCATATCAAGTTGCCAAAGGAATGGAATTTCTGGAATTTAAGTCGTGTGTTCA
CAGAGACCTGGCCGCCAGGAACGTGCTTGTCACCCACGGGAAAGTGGTGAAGATATGTGA
CTTTGGATTGGCTCGAGATATCATGAGTGATTCCAACTATGTTGTCAGGGGCAATGCCCG
TCTGCCTGTAAAATGGATGGCCCCCGAAAGCCTGTTTGAAGGCATCTACACCATTAAGAG
TGATGTCTGGTCATATGGAATATTACTGTGGGAAATCTTCTCACTTGGTGTGAATCCTTA
CCCTGGCATTCCGGTTGATGCTAACTTCTACAAACTGATTCAAAATGGATTTAAAATGGA
TCAGCCATTTTATGCTACAGAAGAAATATACATTATAATGCAATCCTGCTGGGCTTTTGA
CTCAAGGAAACGGCCATCCTTCCCTAATTTGACTTCGTTTTTAGGATGTCAGCTGGCAGA
TGCAGAAGAAGCGATGTATCAGAATGTGGATGGCCGTGTTTCGGAATGTCCTCACACCTA
CCAAAACAGGCGACCTTTCAGCAGAGAGATGGATTTGGGGCTACTCTCTCCGCAGGCTCA
GGTCGAAGATTCGTAGAGGAACAATTTAGTTTTAAGGACTTCATCCCTCCACCTATCCCT
AACAGGCTGTAGATTACCAAAACAAGATTAATTTCATCACTAAAAGAAAATCTATTATCA
ACTGCTGCTTCACCAGACTTTTCTCTAGAAGCTGTCTGCGTTTACTCTTGTTTTCAAAGG
GACTTTTGTAAAATCAAATCATCCTGTCACAAGGCAGGAGGAGCTGATAATGAACTTTAT
TGGAGCATTGATCTGCATCCAAGGCCTTCTCAGGCTGGCTTGAGTGAATTGTGTACCTGA
AGTACAGTATATTCTTGTAAATACATAAAACAAAAGCATTTTGCTAAGGAGAAGCTAATA
TGATTTTTTAAGTCTATGTTTTAAAATAATATGTAAATTTTTCAGCTATTTAGTGATATA
TTTTATGGGTGGGAATAAAATTTCTACTACAGAATTGCCCATTATTGAATTATTTACATG
GTATAATTAGGGCAAGTCTTAACTGGAGTTCACGAACCCCCTGAAATTGTGCACCCATAG
CCACCTACACATTCCTTCCAGAGCACGTGTGCTTTTACCCCAAGATACAAGGAATGTGTA
GGCAGCTATGGTTGTCACAGCCTAAGATTTCTGCAACAACAGGGGTTGTATTGGGGGAAG
TTTATAATGAATAGGTGTTCTACCATAAAGAGTAATACATCACCTAGACACTTTGGCGGC
CTTCCCAGACTCAGGGCCAGTCAGAAGTAACATGGAGGATTAGTATTTTCAATAAAGTTA
CTCTTGTCCCCACAAAAAAA

Protein Sequence

>2322 : length: 993
MPALARDGGQLPLLVVFSAMIFGTITNQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESP
EDLGCALRPQSSGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVFKHSSLNCQPHFDL
QNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQD
ALVCISESVPEPIVEWVLCDSQGESCKEESPAVVKKEEKVLHELFGTDIRCCARNELGRE
CTRLFTIDLNQTPQTTLPQLFLKVGEPLWIRCKAVHVNHGFGLTWELENKALEEGNYFEM
STYSTNRTMIRILFAFVSSVARNDTGYYTCSSSKHPSQSALVTIVEKGFINATNSSEDYE
IDQYEEFCFSVRFKAYPQIRCTWTFSRKSFPCEQKGLDNGYSISKFCNHKHQPGEYIFHA
ENDDAQFTKMFTLNIRRKPQVLAEASASQASCFSDGYPLPSWTWKKCSDKSPNCTEEITE
GVWNRKANRKVFGQWVSSSTLNMSEAIKGFLVKCCAYNSLGTSCETILLNSPGPFPFIQD
NISFYATIGVCLLFIVVLTLLICHKYKKQFRYESQLQMVQVTGSSDNEYFYVDFREYEYD
LKWEFPRENLEFGKVLGSGAFGKVMNATAYGISKTGVSIQVAVKMLKEKADSSEREALMS
ELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKE
HNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDEIEYENQKRLEEEEDL
NVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIMSDS
NYVVRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYK
LIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDG
RVSECPHTYQNRRPFSREMDLGLLSPQAQVEDS