ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

23216

Name

TBC1D1

Synonym

TBC|TBC1;TBC1 (tre-2/USP6, BUB2, cdc16) domain family, member 1;TBC1D1;TBC1 (tre-2/USP6, BUB2, cdc16) domain family, member 1

Definition

TBC1 domain family member 1

Position

4p14

Gene Type

protein-coding

External Links

Links to cell senescence gene database

23216

Links to epithelial mesenchymal transition gene database

23216

Links to ovarian cancer gene database

23216

Links to endometrial cancer gene database

23216

Links to iHOP

23216

Sequence Information

Nucleotide Sequence

>23216 : length: 6084
CTCCTCTTCGGCTGCTGCTCCTGGTGCCGCCACCGTCCGCCGGTGCCTGTTGCTGCCGCC
GCCGCGGGACCTGCTGTGTCCTCAGCTGGGTGGAGAAGAGGCGGGCGCCGAGCCGAGGGG
AGCCCCCTCCCCGTCCCCCCGCGGCGGGAAGAGCGCAGCCAGCCGGGTGCGATGGACTCC
CCGCCCGCCCAGGCCGTCCCCAGGATGCCCCCAAGCACCTGCGCGTCCCGGCCCGGCCCC
GGGCTCTGAGCGCGCCGCGGCACAGGTTTCTGCATATGAAGTGTGTAAAATAGATTGCTT
GATCCAAAACAGAAAAACAGTGATAACTGTTTTGCTGAGTTCCCAGACCCTTCCCAAGAT
GGAACCAATAACATTCACAGCAAGGAAACATCTGCTTTCTAACGAGGTCTCGGTGGATTT
TGGCCTGCAGCTGGTGGGCTCCCTGCCTGTGCATTCCCTGACCACCATGCCCATGCTGCC
CTGGGTTGTGGCTGAGGTGCGAAGACTCAGCAGGCAGTCCACCAGAAAGGAACCTGTAAC
CAAGCAAGTCCGGCTTTGCGTTTCACCCTCTGGACTGAGATGTGAACCTGAGCCAGGGAG
AAGTCAACAGTGGGATCCCCTGATCTATTCCAGCATCTTTGAGTGCAAGCCTCAGCGTGT
TCACAAACTGATTCACAACAGTCATGACCCAAGTTACTTTGCTTGTCTGATTAAGGAAGA
CGCTGTCCACCGGCAGAGTATCTGCTATGTGTTCAAAGCCGATGATCAAACAAAAGTGCC
TGAGATCATCAGCTCCATCCGTCAGGCGGGGAAGATCGCCCGGCAGGAGGAGCTGCACTG
CCCGTCCGAGTTCGACGACACGTTTTCCAAGAAGTTCGAGGTGCTCTTCTGCGGCCGCGT
GACGGTGGCGCACAAGAAGGCTCCGCCGGCCCTGATCGACGAGTGCATCGAGAAGTTCAA
TCACGTCAGCGGCAGCCGGGGGTCCGAGAGCCCCCGCCCCAACCCGCCCCATGCCGCGCC
CACAGGGAGCCAGGAGCCTGTGCGCAGGCCCATGCGCAAGTCCTTCTCCCAGCCCGGCCT
GCGCTCGCTGGCCTTTAGGAAGGAGCTGCAGGATGGGGGCCTCCGAAGCAGCGGCTTCTT
CAGCTCCTTCGAGGAGAGCGACATTGAGAACCACCTCATTAGCGGACACAATATTGTGCA
GCCCACAGATATCGAGGAAAATCGAACTATGCTCTTCACGAAGGACAAGAGTAAAAGGCT
ACCTGCCACTCTCTGCTGGCTGAAATACAGTTCAGAAACAATTGGCCAGTCTGAAGTTTA
CCTCATCAGTCCTGACACCAAAAAAATAGCATTGGAGAAAAATTTTAAGGAGATATCCTT
TTGCTCTCAGGGCATCAGACACGTGGACCACTTTGGGTTTATCTGTCGGGAGTCTTCCGG
AGGTGGCGGCTTTCATTTTGTCTGTTACGTGTTTCAGTGCACAAATGAGGCTCTGGTTGA
TGAAATTATGATGACCCTGAAACAGGCCTTCACGGTGGCCGCAGTGCAGCAGACAGCTAA
GGCGCCAGCCCAGCTGTGTGAGGGCTGCCCCCTGCAAAGCCTGCACAAGCTCTGTGAGAG
GATAGAGGGAATGAATTCTTCCAAAACAAAACTAGAACTGCAAAAGCACCTGACGACATT
AACCAATCAGGAGCAGGCGACTATTTTTGAAGAGGTTCAGAAATTGAGACCGAGAAATGA
GCAGCGAGAGAATGAATTGATTATTTCTTTTCTGAGATGTTTATATGAAGAGAAACAGAA
AGAACACATCCATATTGGGGAGATGAAGCAGACATCGCAGATGGCAGCAGAGAATATTGG
AAGTGAATTACCACCCAGTGCCACTCGATTTAGGCTAGATATGCTGAAAAACAAAGCAAA
GAGATCTTTAACAGAGTCTTTAGAAAGTATTTTGTCCCGGGGTAATAAAGCCAGAGGCCT
GCAGGAACACTCCATCAGTGTGGATCTGGATAGCTCCCTGTCTAGTACATTAAGTAACAC
CAGCAAAGAGCCATCTGTGTGTGAAAAGGAGGCCTTGCCCATCTCTGAGAGCTCCTTTAA
GCTCCTCGGCTCCTCGGAGGACCTGTCCAGTGACTCGGAGAGTCATCTCCCAGAAGAGCC
AGCTCCGCTGTCGCCCCAGCAGGCCTTCAGGAGGCGAGCAAACACCCTGAGTCACTTCCC
CATCGAATGCCAGGAACCTCCACAACCTGCCCGGGGGTCCCCGGGGGTTTCGCAAAGGAA
ACTTATGAGGTATCACTCAGTGAGCACAGAGACGCCTCATGAACGAAATGTGGATCCTTC
ACCTGTGGGTGAGTCTAAGCACCGCCCAGGTCAGTCTTCAGCTCCTGCTCCTCCACCTCG
TCTTAACCCCTCCGCCTCCTCGCCAAACTTTTTTAAGTACCTAAAACATAATTCCAGTGG
AGAACAAAGTGGGAATGCTGTGCCAAAGAGCATCTCCTACCGTAATGCCCTGCGGAAAAA
ACTTCATTCTTCTTCCTCTGTGCCAAATTTTCTAAAATTTCTGGCTCCTGTAGATGAAAA
TAACACCTCTGATTTTATGAACACAAAAAGGGACTTTGAATCCAAAGCAAACCATCTTGG
TGATTCTGGTGGGACTCCTGTGAAGACCCGGAGGCATTCCTGGAGGCAGCAGATATTCCT
CCGAGTAGCCACCCCGCAGAAGGCGTGCGATTCTTCCAGCAGATATGAAGAACCTCACTG
TGGATCGCCATCGTTGGCCTGTACTGAAGATTATTCAGAGCTGGGAGAGCTTCCCCCACG
ATCTCCTTTAGAACCAGTTTGTGAAGATGGGCCCTTTGGCCCCCCACCAGAGGAAAAGAA
AAGGACATCTCGTGAGCTCCGAGAGCTGTGGCAAAAGGCTATTCTTCAACAGATACTGCT
GCTTAGAATGGAGAAGGAAAATCAGAAGCTCCAAGCCTCTGAAAATGATTTGCTGAACAA
GCGCCTGAAGCTCGATTATGAAGAAATTACTCCCTGTCTTAAAGAAGTAACTACAGTGTG
GGAAAAGATGCTTAGCACTCCAGGAAGATCAAAAATTAAGTTTGACATGGAAAAAATGCA
CTCGGCTGTTGGGCAAGGTGTGCCACGTCATCACCGAGGTGAAATCTGGAAATTTCTAGC
TGAGCAATTCCACCTTAAACACCAGTTTCCCAGCAAACAGCAGCCAAAGGATGTGCCATA
CAAAGAACTCTTAAAGCAGCTGACTTCCCAGCAGCATGCGATTCTTATTGACCTTGGGCG
AACCTTTCCTACACACCCATACTTCTCTGCCCAGCTTGGAGCAGGACAGCTATCGCTTTA
CAACATTTTGAAGGCCTACTCACTTCTAGACCAGGAAGTGGGATATTGCCAAGGTCTCAG
CTTTGTAGCAGGCATTTTGCTTCTTCATATGAGTGAGGAAGAGGCGTTTAAAATGCTCAA
GTTTCTGATGTTTGACATGGGGCTGCGGAAACAGTATCGGCCAGACATGATTATTTTACA
GATCCAGATGTACCAGCTCTCGAGGTTGCTTCATGATTACCACAGAGACCTCTACAATCA
CCTGGAGGAGCACGAGATCGGCCCCAGCCTCTACGCTGCCCCCTGGTTCCTCACCATGTT
TGCCTCACAGTTCCCGCTGGGATTCGTAGCCAGAGTCTTTGATATGATTTTTCTTCAGGG
AACAGAGGTCATATTTAAAGTGGCTTTAAGTCTGTTGGGAAGCCATAAGCCCTTGATTCT
GCAGCATGAAAACCTAGAAACCATAGTTGACTTTATAAAAAGCACGCTACCCAACCTTGG
CTTGGTACAGATGGAAAAGACCATCAATCAGGTATTTGAAATGGACATCGCTAAACAGTT
ACAAGCTTATGAAGTTGAGTACCACGTCCTTCAAGAAGAACTTATCGATTCCTCTCCTCT
CAGTGACAACCAAAGAATGGATAAATTAGAGAAAACCAACAGCAGCTTACGCAAACAGAA
CCTTGACCTCCTTGAACAGTTGCAGGTGGCAAATGGTAGGATCCAAAGCCTTGAGGCCAC
CATTGAGAAGCTCCTGAGCAGTGAGAGCAAGCTGAAGCAGGCCATGCTTACCTTAGAACT
GGAGCGGTCGGCCCTGCTGCAGACGGTGGAGGAGCTGCGGCGGCGGAGCGCAGAGCCCAG
CGACCGGGAGCCTGAGTGCACGCAGCCCGAGCCCACGGGCGACTGACAGCTCTGCAGGAG
AGATTGCAACACCATCCCACACTGTCCAGGCCTTAACTGAGAGGGACAGAAGACGCTGGA
AGGAGAGAAGGAAGCGGGAAGTGTGCTTCTCAGGGAGGAAACCGGCTTGCCAGCAAGTAG
ATTCTTACGAACTCCAACTTGCAATTCAGGGGGCATGTCCCAGTGTTTTTTTTGTTGTTT
TTAGATACTAAATCGTCCCTTCTCCAGTCCTGATTACTGTACACAGTAGCTTTAGATGGC
GTGGACGTGAATAAATGCAACTTATGTTTTCTTGTTGGTTCCTTTTTGAGTGTCACTGTG
TTTGTAAAGAGCATTCACAATACGGTGGAATTTCAAAAGCTGGAAGAGCTCGAGATCATG
CCTCAGGCAAAGGCGTGGGTCCATCGTTCTTCCGAGAGGGTTTGTGTGGCGACTACACCC
TCAGCGTCCCTGGCAAGGTGCAGTTGGCTCTCGCCCATTCTTGTTATGGAAACCTAAGAT
GATCATTGGGAAGATCAGTGATCTTGGGTCATTGATCCCTGGCTCAGAGGATAGCGGTTT
CCATCATAAACCAAGATGATGAGTTCAGCCTTTATCCCTCGTGGTTCCACTAGATGTAAC
TTAAAGGAGTTAACATTTGAGGACTTTGTTCTACATCAGATTTTACTATTTGAATGTTTA
AGATCACTTTATTGAATTTGAAGATCATCAAATTAAATAAAATGATTTATTTAATTTGGA
TATCCTGATCACTGTCAAGTGAAATGGATCTCTCTCTTTGGTATTTAAGGAAGTTTGTCT
TTAAAAAAAAAATAGAGTGTTTTCATACATTTTTGCTTATCCCATAAGTACAGTTGATCA
AAGTCATAGTAGGTAAATGCTTTATGGGACAGCTGACACCTTTTAGACCCTACCAGGTAT
TGCTAGCATGTGAGCTGCAGTTGTGGGGTCTGAGATATTTCTTTGTGGTAGTTTCATACC
CATACTATAGAGTCATGTATTTATTTTTGCCTGTTGTGTGATGTAATGCAATCATGTTCC
TTTGAGTCTCCATCCCTTGGAAATCTGACTTCTTGCAGAAGGAGTAGGCACATCAAGATA
TTCAGGGGTGCCCCAAGAGTCTGGGACTTTCAAAAAAAAAAGATCAGGCTGAAACTGCAG
TCAGATTTATGACAGCTGACAGTTTTTCAGAGGTCGCACACAGTGACTCTCCTCTCTCAG
GATGACGAGGACCTGTGCCTTCAACAAGCAAAATGCTGCTCACGGTTGTCCTGCTTGCAG
CCAGTCACTGTGTAAAGCCTCTCTGATGTGCACTTAAGAGTGGGTTGCTTTCTCACAAAG
ATGGGGTTCTGTGCAGTCACAGGTCACTTCCTTGACAACACAATCATTTCTGATCTTTAT
CACTGTAACCACGTCTTCTATTCCATAGGAGTTTCTTTTGATTCTCTCAGTTGCGGGGGG
CATCTCTTAATCCTGGGGTAAAAGGAGAGATTGCCATACTTAGACTCACTGTGAGTCTCC
CCGGCCATTTCACGAGGAGACCACAGTGCTGCCACCAGTGCCTAAACAGGTGGCTGGCAT
TCGAGACTTCCTCCTGTTCCCTGGGTCAGAGGATAGCGGTTTCCATCATAAACCAAGATG
ATGAGTTCAGCCTTTATCCCTCGTGGTTCCGCTAGATGTAACTTATAGGAGTTAACATTT
GAGGACTTTGTTCTGCATCAGATCTTACTATTTGAATGTTTACTGTTGGATTTTGGGCAT
CTTATTACTGTTACTCAAAAACATTGACTCTGCATCAAGAAAGAAACAAGAAAGCAATAA
AACAAGAAATAATTCATGCTCACA

Protein Sequence

>23216 : length: 1295
MEPITFTARKHLLSNEVSVDFGLQLVGSLPVHSLTTMPMLPWVVAEVRRLSRQSTRKEPV
TKQVRLCVSPSGLRCEPEPGRSQQWDPLIYSSIFECKPQRVHKLIHNSHDPSYFACLIKE
DAVHRQSICYVFKADDQTKVPEIISSIRQAGKIARQEELHCPSEFDDTFSKKFEVLFCGR
VTVAHKKAPPALIDECIEKFNHVSGSRGSESPRPNPPHAAPTGSQEPVRRPMRKSFSQPG
LRSLAFRKELQDGGLRSSGFFSSFEESDIENHLISGHNIVQPTDIEENRTMLFTKDKSKR
LPATLCWLKYSSETIGQSEVYLISPDTKKIALEKNFKEISFCSQGIRHVDHFGFICRESS
GGGGFHFVCYVFQCTNEALVDEIMMTLKQAFTVAAVQQTAKAPAQLCEGCPLQSLHKLCE
RIEGMNSSKTKLELQKHLTTLTNQEQATIFEEVQKLRPRNEQRENELIISFLRCLYEEKQ
KEHIHIGEMKQTSQMAAENIGSELPPSATRFRLDMLKNKAKRSLTESLESILSRGNKARG
LQEHSISVDLDSSLSSTLSNTSKEPSVCEKEALPISESSFKLLGSSEDLSSDSESHLPEE
PAPLSPQQAFRRRANTLSHFPIECQEPPQPARGSPGVSQRKLMRYHSVSTETPHERNVDP
SPVGESKHRPGQSSAPAPPPRLNPSASSPNFFKYLKHNSSGEQSGNAVPKSISYRNALRK
KLHSSSSVPNFLKFLAPVDENNTSDFMNTKRDFESKANHLGDSGGTPVKTRRHSWRQQIF
LRVATPQKACDSSSRYEEPHCGSPSLACTEDYSELGELPPRSPLEPVCEDGPFGPPPEEK
KRTSRELRELWQKAILQQILLLRMEKENQKLQASENDLLNKRLKLDYEEITPCLKEVTTV
WEKMLSTPGRSKIKFDMEKMHSAVGQGVPRHHRGEIWKFLAEQFHLKHQFPSKQQPKDVP
YKELLKQLTSQQHAILIDLGRTFPTHPYFSAQLGAGQLSLYNILKAYSLLDQEVGYCQGL
SFVAGILLLHMSEEEAFKMLKFLMFDMGLRKQYRPDMIILQIQMYQLSRLLHDYHRDLYN
HLEEHEIGPSLYAAPWFLTMFASQFPLGFVARVFDMIFLQGTEVIFKVALSLLGSHKPLI
LQHENLETIVDFIKSTLPNLGLVQMEKTINQVFEMDIAKQLQAYEVEYHVLQEELIDSSP
LSDNQRMDKLEKTNSSLRKQNLDLLEQLQVANGRIQSLEATIEKLLSSESKLKQAMLTLE
LERSALLQTVEELRRRSAEPSDREPECTQPEPTGD