ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2315

Name

MLANA

Synonym

MART-1|MART1;melan-A;MLANA;melan-A

Definition

antigen LB39-AA|antigen SK29-AA|melanoma antigen recognized by T-cells 1|protein Melan-A

Position

9p24.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

2315

Links to epithelial mesenchymal transition gene database

2315

Links to ovarian cancer gene database

2315

Links to endometrial cancer gene database

2315

Links to iHOP

2315

Sequence Information

Nucleotide Sequence

>2315 : length: 1524
AGCAGACAGAGGACTCTCATTAAGGAAGGTGTCCTGTGCCCTGACCCTACAAGATGCCAA
GAGAAGATGCTCACTTCATCTATGGTTACCCCAAGAAGGGGCACGGCCACTCTTACACCA
CGGCTGAAGAGGCCGCTGGGATCGGCATCCTGACAGTGATCCTGGGAGTCTTACTGCTCA
TCGGCTGTTGGTATTGTAGAAGACGAAATGGATACAGAGCCTTGATGGATAAAAGTCTTC
ATGTTGGCACTCAATGTGCCTTAACAAGAAGATGCCCACAAGAAGGGTTTGATCATCGGG
ACAGCAAAGTGTCTCTTCAAGAGAAAAACTGTGAACCTGTGGTTCCCAATGCTCCACCTG
CTTATGAGAAACTCTCTGCAGAACAGTCACCACCACCTTATTCACCTTAAGAGCCAGCGA
GACACCTGAGACATGCTGAAATTATTTCTCTCACACTTTTGCTTGAATTTAATACAGACA
TCTAATGTTCTCCTTTGGAATGGTGTAGGAAAAATGCAAGCCATCTCTAATAATAAGTCA
GTGTTAAAATTTTAGTAGGTCCGCTAGCAGTACTAATCATGTGAGGAAATGATGAGAAAT
ATTAAATTGGGAAAACTCCATCAATAAATGTTGCAATGCATGATACTATCTGTGCCAGAG
GTAATGTTAGTAAATCCATGGTGTTATTTTCTGAGAGACAGAATTCAAGTGGGTATTCTG
GGGCCATCCAATTTCTCTTTACTTGAAATTTGGCTAATAACAAACTAGTCAGGTTTTCGA
ACCTTGACCGACATGAACTGTACACAGAATTGTTCCAGTACTATGGAGTGCTCACAAAGG
ATACTTTTACAGGTTAAGACAAAGGGTTGACTGGCCTATTTATCTGATCAAGAACATGTC
AGCAATGTCTCTTTGTGCTCTAAAATTCTATTATACTACAATAATATATTGTAAAGATCC
TATAGCTCTTTTTTTTTGAGATGGAGTTTCGCTTTTGTTGCCCAGGCTGGAGTGCAATGG
CGCGATCTTGGCTCACCATAACCTCCGCCTCCCAGGTTCAAGCAATTCTCCTGCCTTAGC
CTCCTGAGTAGCTGGGATTACAGGCGTGCGCCACTATGCCTGACTAATTTTGTAGTTTTA
GTAGAGACGGGGTTTCTCCATGTTGGTCAGGCTGGTCTCAAACTCCTGACCTCAGGTGAT
CTGCCCGCCTCAGCCTCCCAAAGTGCTGGAATTACAGGCGTGAGCCACCACGCCTGGCTG
GATCCTATATCTTAGGTAAGACATATAACGCAGTCTAATTACATTTCACTTCAAGGCTCA
ATGCTATTCTAACTAATGACAAGTATTTTCTACTAAACCAGAAATTGGTAGAAGGATTTA
AATAAGTAAAAGCTACTATGTACTGCCTTAGTGCTGATGCCTGTGTACTGCCTTAAATGT
ACCTATGGCAATTTAGCTCTCTTGGGTTCCCAAATCCCTCTCACAAGAATGTGCAGAAGA
AATCATAAAGGATCAGAGATTCTG

Protein Sequence

>2315 : length: 118
MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDK
SLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP