ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2313

Name

FLI1

Synonym

EWSR2|SIC-1;Fli-1 proto-oncogene, ETS transcription factor;FLI1;Fli-1 proto-oncogene, ETS transcription factor

Definition

Ewing sarcoma breakpoint region 2|Friend leukemia integration 1 transcription factor|Friend leukemia virus integration 1|transcription factor ERGB

Position

11q24.1-q24.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

PDGF signaling pathway;PANTHER;P00047

Disease

Cancers of soft tissues and bone;KEGG DISEASE

Disease

Cancers;KEGG DISEASE

Disease

Ewing's sarcoma;KEGG DISEASE;H00035

Disease

Ewing's sarcoma;GAD

External Links

Links to cell senescence gene database

2313

Links to epithelial mesenchymal transition gene database

2313

Links to ovarian cancer gene database

2313

Links to endometrial cancer gene database

2313

Links to iHOP

2313

Sequence Information

Nucleotide Sequence

>2313 : length: 4166
AGAGAAGAGAGAGGAGAGCTCGAGGCGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGA
GAGAGAGAGAGAGAGAGATAGGACTTCCTCCCCGATTCGCAAAGTGAAGTCACTTCCCAA
AATTAGCTGAAAAAAAAGTTTCATCCGGTTAACTGTCTCTTTCGCTCCGCTACAACAACA
AACGTGCACAGGGGAGTGAGGGCAGGGCGCTCGCAGGGGGCACGCAGGGAGGGCCCAGGG
CGCCAGGGAGGCCGCGCCGGGCTAATCCGAAGGGGCTGCGAGGTCAGGCTGTAACCGGGT
CAATGTGTGGAATATTGGGGGGCTCGGCTGCAGACTTGGCCAAATGGACGGGACTATTAA
GGAGGCTCTGTCGGTGGTGAGCGACGACCAGTCCCTCTTTGACTCAGCGTACGGAGCGGC
AGCCCATCTCCCCAAGGCCGACATGACTGCCTCGGGGAGTCCTGACTACGGGCAGCCCCA
CAAGATCAACCCCCTCCCACCACAGCAGGAGTGGATCAATCAGCCAGTGAGGGTCAACGT
CAAGCGGGAGTATGACCACATGAATGGATCCAGGCGCCAGCTGCCTCATTAAAGAGCAGC
CTTTTATGCTGGGCTTCACCTGTACCCACCCTGAGCGGCAGCCGTGGAGCCCCATGGCCG
CACGCAGGGCTTGCGCTGGCTGGAGGAGGCACGGTGCTTGGGAGCTGCAAGAATGGAGGG
AGGACTGGCAGGCGAGCGGGCGAGGGAGTCTCCGGTGGACTGCAGCGTTAGCAAATGCAG
CAAGCTGGTGGGCGGAGGCGAGTCCAACCCCATGAACTACAACAGCTATATGGACGAGAA
GAATGGCCCCCCTCCTCCCAACATGACCACCAACGAGAGGAGAGTCATCGTCCCCGCAGA
CCCCACACTGTGGACACAGGAGCATGTGAGGCAATGGCTGGAGTGGGCCATAAAGGAGTA
CAGCTTGATGGAGATCGACACATCCTTTTTCCAGAACATGGATGGCAAGGAACTGTGTAA
AATGAACAAGGAGGACTTCCTCCGCGCCACCACCCTCTACAACACGGAAGTGCTGTTGTC
ACACCTCAGTTACCTCAGGGAAAGTTCACTGCTGGCCTATAATACAACCTCCCACACCGA
CCAATCCTCACGATTGAGTGTCAAAGAAGACCCTTCTTATGACTCAGTCAGAAGAGGAGC
TTGGGGCAATAACATGAATTCTGGCCTCAACAAAAGTCCTCCCCTTGGAGGGGCACAAAC
GATCAGTAAGAATACAGAGCAACGGCCCCAGCCAGATCCGTATCAGATCCTGGGCCCGAC
CAGCAGTCGCCTAGCCAACCCTGGAAGCGGGCAGATCCAGCTGTGGCAATTCCTCCTGGA
GCTGCTCTCCGACAGCGCCAACGCCAGCTGTATCACCTGGGAGGGGACCAACGGGGAGTT
CAAAATGACGGACCCCGATGAGGTGGCCAGGCGCTGGGGCGAGCGGAAAAGCAAGCCCAA
CATGAATTACGACAAGCTGAGCCGGGCCCTCCGTTATTACTATGATAAAAACATTATGAC
CAAAGTGCACGGCAAAAGATATGCTTACAAATTTGACTTCCACGGCATTGCCCAGGCTCT
GCAGCCACATCCGACCGAGTCGTCCATGTACAAGTACCCTTCTGACATCTCCTACATGCC
TTCCTACCATGCCCACCAGCAGAAGGTGAACTTTGTCCCTCCCCATCCATCCTCCATGCC
TGTCACTTCCTCCAGCTTCTTTGGAGCCGCATCACAATACTGGACCTCCCCCACGGGGGG
AATCTACCCCAACCCCAACGTCCCCCGCCATCCTAACACCCACGTGCCTTCACACTTAGG
CAGCTACTACTAGAAGCTTACTCATCAGTGGCCTTCTAGCTGAAGCCCATCCTGCACACT
TACTGGATGCTTTGGACTCAACAGGACATATGTGGCCTTGAAGGGAAGACAAAACTGGAT
GTTCTTTCTTGTTGGATAGAACCTTTGTATTTGTTCTTTAAAAACATTTTTTTTAATGTT
GGTAACTTTTGCTTCCTCTACCTGAACAAAGAGATGAATAATTCCATGGGCCAGTATGCC
AGTTTGAATTCTCAGTCTCCTAGCATCTTGTGAGTTGCATATTAAGATTACTGGAATGGT
TAAGTCATGGTTCTGAGAAAGAAGCTGTACGTTTTCTTTATGTTTTTATGACCAAAGCAG
TTTCTTGTCAATACACGGGGTTCAGTATGACACAGAATCATGGACTTAACCCGTCATGTT
CTGGTTTGAGATTTAGTGACAAATAGAGGTGGGAAGCTTATAATCTAATTTTAGGAGGAC
CAAATTCAGTGGATGGCAACTGGAACATTGATTGTAAGGCCAGTGAAGTTTTCACCCAAC
TGGAATTTGATGGAAAGAAGGTTTGTGTGTTTAAGACGCCAAGGGCATTGCAGAATCCCT
CTCAGTGGACAGTATGCACTCAGCTGACCACTCTCTCTAGAAATAGTCAAGATATGAACT
AAGAAATTTTAATGCAAATACATACATTCCTGAAAGACGGGGAATTAAATTACTAATTTT
TTTTTTTTTTTAAATGATGACAGTGGTCCCAGAACTTGGAAAAGTTGTAGGGATTTCTAA
ACTCAAGCAGATTCGCAAGTGCTGTGCGCTTGTCAGACCATCAGACCAGGGCCAACCAAT
CAGAAGGCAACTTACTGTATAAATTATGCAGAGTTATTTTCCTATATCTCACAGTATTAA
AAATAAATAATTAAAAATTAAGAATAAATAAACGAGTTGACCTCGGTCACAAAAGCAGTT
TTACTATCGAATCAATCGCTGTTATTTTTTTTAATGTAATTTGTACATCTTTTTTCAATC
TGTACATTTGGGCTGTCTGTATGTTTTTATAGCTGGTTTTTAAAAAGCATAATATGCCTA
TAGCTGAAAAGGAAACAGGGCTGTTTAAGTCACTGACTTATGAGAAAGCAAAGCACTGGT
ACAGTTATTTAACAGGCATACACAAGCAGGGAAAAGATAATCCATTTAGATCTTTAATGC
TTTGGAAATGCGTGTAACAGTACTGCAATAATCACAGCTCTGGGAAAAACAACGAAACTT
TCCCTTGTGGAGAGGAGGGATTTTCCTGCTCTATATAAGCAACATATTTTTAGACATTAA
AATATATATAATTTTGCAGGTAATTGTTGACTTTTTTAACTATATTAAGTGTTAAGCTGA
CAACTGTCAAAGAAGACCATGTTGTAAAATAATTTGACTAAATAAATGGTTCCTTCTCTC
AGTGCTGAGGACAGTTTTCTTATTTACCGCCCCCGTTAGGTCAAAGGGTTTTCCCTGGGG
AACTTTCCTATTTACTTCTTGCACTATCAAGAATTTTTCGAATGTACCTACTGCAGTACA
GCAGAAGGTAAAAAATCAGTGTGGTTTTTCATTGTTGTTGATGATGTTTGTAGTGTTTTT
GTGTGTGTTATTTAAATCTTCCTCCAGCCTAAAAGGGTTTTATAAAACAGCAGCTAAGGC
CATGGATAAACCTGTATGTAAGGACTGGAGCAAAGCGAGCTGGTCTATCCAGACTGGTCT
GTGAGATTTAACTCTGCAGCCTCCCCTGGGCACTTCAGACCCAGACGGCCACCTTCTGCC
ACTCCAGCAAAGAATAAGCGCCCTGCTTCCTTCAGGTCTCAGACCAGGACTTTATGGCTC
ATGCAGATTTTTAAGGTCATTTTTCTTCCCAAGGAAGAAACTTGCCTCCAGTTCCTTCAC
TGTTAGGTAGCTTATTTTCATTTTCTCTATTTTACAATGAAAAGAGTGAGACCTGGGAAG
TCCTTGATTTGCAAGGAATTAGACTCACAGCATTGGTAACCCTAGAACCTTCTTAGGGTA
ACACTAAGTACCTTCTAGACAACATGTCTACCTAAATGAAATGGGATGTGTTTCGGAACA
TTTGTCTCCAGTTTTTTTTTAATCTTGCACCCTGCCATTTAAAAAGATGTGTAAAGCACA
TATTCTCAACATATGCACATTGATTTATAAATCATATATACAAACTGTTACATTATTCTT
CATATTAGAAAACAAATACAAAATAGAACATTTTAAATGGTGATATAAAAATAAATTGAA
ACTGAAATTCTAAAAAAAAAAAAAAA

Protein Sequence

>2313 : length: 452
MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINPLPPQQEWINQ
PVRVNVKREYDHMNGSRESPVDCSVSKCSKLVGGGESNPMNYNSYMDEKNGPPPPNMTTN
ERRVIVPADPTLWTQEHVRQWLEWAIKEYSLMEIDTSFFQNMDGKELCKMNKEDFLRATT
LYNTEVLLSHLSYLRESSLLAYNTTSHTDQSSRLSVKEDPSYDSVRRGAWGNNMNSGLNK
SPPLGGAQTISKNTEQRPQPDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSANASCI
TWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF
DFHGIAQALQPHPTESSMYKYPSDISYMPSYHAHQQKVNFVPPHPSSMPVTSSSFFGAAS
QYWTSPTGGIYPNPNVPRHPNTHVPSHLGSYY