ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

23081

Name

KDM4C

Synonym

GASC1|JHDM3C|JMJD2C|TDRD14C;lysine (K)-specific demethylase 4C;KDM4C;lysine (K)-specific demethylase 4C

Definition

JmjC domain-containing histone demethylation protein 3C|gene amplified in squamous cell carcinoma 1 protein|jumonji domain-containing protein 2C|lysine-specific demethylase 4C|tudor domain containing 14C

Position

9p24.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Coregulation of Androgen receptor activity;PID Curated;200038

External Links

Links to cell senescence gene database

23081

Links to epithelial mesenchymal transition gene database

23081

Links to ovarian cancer gene database

23081

Links to endometrial cancer gene database

23081

Links to iHOP

23081

Sequence Information

Nucleotide Sequence

>23081 : length: 5328
AGTTTTGCTTCCAGAGGCTGACACGCTCCTGCGCGGTAGTTGTTAAAGGGTTGGGACACG
AAGATACTCTTCGCCTATTCGGGATCTCCCATTGTGGGAAGGAGGCTCAGTGGTCCCGGC
CACCGGGTGAAGGGAGAACGGGAACACAGCGCTGTCATCGCCGGAGAGCTGCGAGCCCCG
ACTTTCTCGCCAGGCTCTCCAGTACATTCCGAGGCTCCACCCCGGTAACGCCACGCTGAC
GTCCGCGCGTCGGAGGCCGCCATAGGTGCGCGTCGGCGCCCAGGAGGACGTGTGGCGCGT
GGACTACATCAGGTCCAGCCCTGCGGGACCCCAGCCAGCGCTTCCGGGCAAGGTTCTGTG
CACCTGTTTTCTCCTTCTACGCGAGTATCTTTCCCCTCCGGAAAGAATGGGATATGCCTG
TGTCCAAAGGACAAGAAGATGCGCGCCAGCAAGCCTAAGTTAACCACAGCGCGGAAGTTG
AGCCCAAAGCAAGAGCGTGCCGGGCACCTTTAAGCTGTTTGTAAGCCCACGTGACTCACC
AAGTGCGGGCCCCAGCGGTCACGTGACGGCGCGCGCGCCCTCGCGCAGGGAGAGCCGGCG
GTGCGCGCGCCTTCGCCGCTGCCTCCCACCCACCCCCTCGACGGGAGGGTGAGGCGCGGC
GCAGTGATCGGGCGGCCGGGGTCCTGTGCGCGTGCGCAGCGAACAGCTGTCACCTAGTGC
GGAACAAGTCTCCCAAATTTCCCAAATCTCCCTGGGCCGGAGGCCACTGTCTTCTCTTCC
TCCTCCACCGAGTCGTGCTCTCGCCCCAACCCGCGCGCCAGACACTGCCCTAACCATCAT
GGAGGTGGCCGAGGTGGAAAGTCCTCTGAACCCCAGCTGTAAGATAATGACCTTCAGACC
CTCCATGGAGGAGTTCCGGGAGTTCAACAAATACCTTGCATACATGGAGTCTAAAGGAGC
CCATCGTGCGGGTCTTGCAAAGGTGATTCCTCCTAAGGAGTGGAAGCCAAGACAGTGCTA
TGATGACATTGATAATTTGCTCATTCCAGCACCAATTCAGCAGATGGTCACAGGGCAGTC
AGGACTGTTCACTCAGTACAACATCCAGAAAAAAGCGATGACTGTGAAGGAGTTCAGGCA
GCTGGCCAACAGTGGCAAATATTGTACTCCAAGATACTTGGATTACGAAGATTTGGAGCG
CAAGTACTGGAAGAACTTAACTTTTGTGGCACCTATCTATGGTGCAGATATTAATGGGAG
CATATATGATGAGTTTTGATGTCACAGACCCTCTGACAAGGTCTGCGTGTCTTCCTGTGG
TCCTCGGAAAACACCTTGACAACTGCTTCGGTAACTGCATTCCTGATATGTTTCTGAAAG
AACGAATCACCTTCAGAGACAGTGATTCTCAAACTGGAAGCCATGGAGTTCTTTGGGTTT
CAGTGAAAGACTGGACTTTTCCTGTGGTCCTTTCAAGGTAGCCACAGTCTTCTTGTGGCC
CAATTTGCAGCACTGAACCCTGGGCGTAGCTCTGCCATGAAAGGCGATTGAGAAACCATC
AGATCCTATAATTGGGTGTGGATGAATGGAACATAGCTCGCCTCAATACAGTCTTGGATG
TGGTTGAAGAAGAGTGTGGCATTTCTATTGAGGGTGTAAATACCCCATATCTCTATTTTG
GCATGTGGAAGACCACGTTTGCATGGCACACCGAAGACATGGACCTCTATAGCATTAATT
ATCTCCACTTTGGAGAGCCCAAGTCTTGGTATGCTATACCTCCGGAGCATGGAAAACGAC
TTGAAAGACTAGCTCAAGGTTTTTTCCCAAGCAGCTCCCAAGGGTGTGATGCATTTCTTC
GCCACAAGATGACATTGATTTCTCCATCAGTATTGAAGAAATATGGTATTCCCTTTGACA
AGATAACCCAGGAGGCTGGAGAATTCATGATCACTTTCCCATATGGCTACCATGCTGGTT
TTAATCATGGTTTCAACTGTGCAGAATCTACAAATTTTGCTACTGTCAGATGGATTGACT
ATGGAAAAGTTGCCAAATTGTGCACTTGCAGGAAAGACATGGTGAAGATTTCAATGGATA
TCTTTGTGAGGAAATTTCAGCCAGACAGATATCAGCTTTGGAAACAAGGAAAGGATATAT
ACACCATTGATCACACGAAGCCTACTCCAGCATCCACCCCTGAAGTAAAAGCATGGCTGC
AGAGGAGGAGGAAAGTAAGAAAAGCATCCCGAAGCTTCCAGTGTGCTAGGTCTACCTCTA
AAAGGCCTAAGGCTGATGAGGAAGAGGAAGTGTCAGATGAAGTCGATGGGGCAGAGGTCC
CTAACCCCGACTCAGTCACAGATGACCTCAAGGTCAGTGAAAAGTCAGAAGCAGCAGTGA
AGCTGAGGAACACAGAAGCATCTTCAGAAGAAGAGTCATCTGCTAGCAGGATGCAGGTGG
AGCAGAATTTATCAGATCATATCAAACTCTCAGGAAACAGCTGCTTAAGTACATCTGTAA
CAGAAGACATAAAAACTGAGGATGACAAAGCTTATGCATATAGAAGTGTACCTTCTATAT
CCAGTGAGGCTGATGATTCCATTCCATTGTCTAGTGGCTATGAGAAGCCCGAGAAATCAG
ACCCATCCGAGCTTTCATGGCCAAAGTCACCTGAGTCATGCTCATCAGTGGCAGAGAGTA
ATGGTGTGTTAACAGAGGGAGAAGAGAGTGATGTGGAGAGCCATGGGAATGGCCTTGAAC
CTGGGGAAATCCCAGCGGTCCCCAGTGGAGAGAGAAATAGCTTCAAAGTCCCCAGTATAG
CAGAGGGAGAGAACAAAACCTCTAAGAGTTGGCGCCATCCACTTAGCAGGCCTCCAGCAA
GATCTCCGATGACTCTTGTGAAGCAGCAGGCGCCAAGTGATGAAGAATTGCCTGAGGTTC
TGTCCATTGAGGAGGAAGTGGAAGAAACAGAGTCTTGGGCGAAACCTCTCATCCACCTTT
GGCAGACGAAGTCCCCTAACTTCGCAGCTGAGCAAGAGTATAATGCAACAGTGGCCAGGA
TGAAGCCACACTGTGCCATCTGCACTCTGCTCATGCCGTACCACAAGCCAGATAGCAGCA
ATGAAGAAAATGATGCTAGATGGGAGACAAAATTAGATGAAGTCGTTACATCGGAGGGAA
AGACTAAGCCCCTCATACCAGAGATGTGTTTTATTTATAGTGAAGAAAATATAGAATATT
CTCCACCCAATGCCTTCCTTGAAGAGGATGGAACAAGTCTCCTTATTTCCTGTGCAAAGT
GCTGCGTACGGGTTCATGCAAGTTGTTATGGTATTCCTTCTCATGAGATCTGTGATGGAT
GGCTGTGTGCCCGGTGCAAAAGAAATGCGTGGACAGCAGAATGCTGTCTCTGCAATTTGA
GAGGAGGTGCTCTTAAGCAAACGAAGAACAATAAGTGGGCCCATGTCATGTGCGCCGTTG
CGGTCCCAGAAGTTCGATTCACTAATGTCCCAGAAAGGACACAAATAGATGTAGGCAGAA
TACCTTTACAGAGGTTAAAATTGAAATGCATCTTCTGCAGACACCGGGTTAAGAGGGTCT
CTGGAGCCTGCATCCAGTGTTCCTACGGTCGCTGCCCGGCCTCCTTCCATGTCACTTGTG
CCCATGCTGCTGGGGTACTGATGGAGCCTGATGACTGGCCTTATGTGGTGAACATTACAT
GCTTTCGACATAAGGTCAACCCCAACGTGTTCACAGCACAGAGTAAGCACTCAAAAAATG
AAAGTTGTATTGCTACTACTACTTCTGCTGCTGCTGCTGGTGCTACAATCTTATGTGAAC
TGGGCCACAAGTCCAAGGCTTGCGAGAAGGTCATTTCCGTGGGTCAAACGGTCATCACGA
AGCATCGGAACACCCGGTATTACAGTTGCAGAGTGATGGCTGTGACATCGCAGACCTTCT
ATGAGGTCATGTTTGATGATGGCTCCTTTAGCAGAGACACATTTCCTGAGGATATCGTGA
GCCGAGACTGTCTGAAGCTGGGCCCACCTGCTGAGGGAGAAGTCGTCCAAGTCAAGTGGC
CCGATGGCAAACTCTATGGAGCAAAATATTTTGGATCAAATATTGCCCACATGTACCAGG
TTGAGTTTGAAGATGGATCCCAGATAGCAATGAAGAGAGAGGACATCTACACTTTAGATG
AAGAGTTACCCAAGAGAGTGAAAGCTCGATTTTCCACAGCCTCTGACATGCGATTTGAAG
ACACGTTTTATGGAGCAGACATTATCCAAGGGGAGAGAAAGAGACAAAGAGTGCTGAGCT
CCAGGTTTAAGAATGAATATGTGGCCGACCCTGTATACCGCACTTTTTTGAAGAGCTCTT
TCCAGAAGAAGTGCCAGAAGAGACAGTAGTCTGCATACATCGCTGCAGGCCACAGAGCAG
CTTGGGTTGGAAGAGAGAAGATGAAGGGACATCCTTGGGGCTGTGCCGTGAGTTTTGCTG
GCATAGGTGACAGGGTGTGTCTCTGACAGTGGTAAATCGGGTTTCCAGAGTTTGGTCACC
AAAAATACAAAATACACCCAATGAATTGGACGCAGCAATCTGAAATCATCTCTAGTCTTG
CTTTCACTTGTGAGCAGTTGTCTTCTATGATCCCAAAGAAGTTTTCTAAGTGAAAGGAAA
TACTAGTGAATCACCCACAAGGAAAAGCCACTGCCACAGAGGAGGCGGGTCCCCTTGTGC
GGCTTAGGGCCCTGTCAGGAAACACACGGGGACCTCTCTCTCTAGCTCCAGCAGGTGGCA
CCTCGGTACCCAGCGGGTAGGGCGATAATTTATATATTTTCCACAGTCAGGGAAGGACTC
TCACTTATTTGTTTCAAATTGCAGTTTTTATAAAACATTTTTAAAACACAAATGGCATGT
ATGCTAATGAGATTTACCCGTGTGCTATCTGTATTTCCCTTGTACAGAACTTTTACATTT
TTGAATATTCCTATTACTTTTGATTGTGTCTGATGGGAACTGAGTTGTTGGCCTTTGTGA
AATGAAATTTTTGGCTCTTGAGAAAGAATTCTTATGAATTGTTATGCGAATTTTATATAT
TTAAAGAGGGAGATCTGGGGCTGTTATTTTTAAACACTTTTTTTCATAATACATATTCCG
AGTAGATATTTATAAAATATATGTTTCTTTCATTATGTGTTTGTAAAATTAGAGTTTAAA
TAAATATGCTTTGATGCATAGTTTTGAACTAATGTAACATGATTTTTCTTTTTTAAAACA
GCCTGAAAATGTACTAGTGTTTAAAAATAAAGATTTCCATTTTCTCCA

Protein Sequence

>23081 : length: 1089
MEVAEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAKVIPPKEWKPRQC
YDDIDNLLIPAPIQQMVTGQSGLFTQYNIQKKAMTVKEFRQLANSGKYCTPRYLDYEDLE
RKYWKNLTFVAPIYGADINGSIYDEGVDEWNIARLNTVLDVVEEECGISIEGVNTPYLYF
GMWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAQGFFPSSSQGCDAFL
RHKMTLISPSVLKKYGIPFDKITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATVRWID
YGKVAKLCTCRKDMVKISMDIFVRKFQPDRYQLWKQGKDIYTIDHTKPTPASTPEVKAWL
QRRRKVRKASRSFQCARSTSKRPKADEEEEVSDEVDGAEVPNPDSVTDDLKVSEKSEAAV
KLRNTEASSEEESSASRMQVEQNLSDHIKLSGNSCLSTSVTEDIKTEDDKAYAYRSVPSI
SSEADDSIPLSSGYEKPEKSDPSELSWPKSPESCSSVAESNGVLTEGEESDVESHGNGLE
PGEIPAVPSGERNSFKVPSIAEGENKTSKSWRHPLSRPPARSPMTLVKQQAPSDEELPEV
LSIEEEVEETESWAKPLIHLWQTKSPNFAAEQEYNATVARMKPHCAICTLLMPYHKPDSS
NEENDARWETKLDEVVTSEGKTKPLIPEMCFIYSEENIEYSPPNAFLEEDGTSLLISCAK
CCVRVHASCYGIPSHEICDGWLCARCKRNAWTAECCLCNLRGGALKQTKNNKWAHVMCAV
AVPEVRFTNVPERTQIDVGRIPLQRLKLKCIFCRHRVKRVSGACIQCSYGRCPASFHVTC
AHAAGVLMEPDDWPYVVNITCFRHKVNPNVFTAQSKHSKNESCIATTTSAAAAGATILCE
LGHKSKACEKVISVGQTVITKHRNTRYYSCRVMAVTSQTFYEVMFDDGSFSRDTFPEDIV
SRDCLKLGPPAEGEVVQVKWPDGKLYGAKYFGSNIAHMYQVEFEDGSQIAMKREDIYTLD
EELPKRVKARFSTASDMRFEDTFYGADIIQGERKRQRVLSSRFKNEYVADPVYRTFLKSS
FQKKCQKRQ