ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

2308

Name

FOXO1

Synonym

FKH1|FKHR|FOXO1A;forkhead box O1;FOXO1;forkhead box O1

Definition

forkhead box protein O1|forkhead box protein O1A|forkhead, Drosophila, homolog of, in rhabdomyosarcoma

Position

13q14.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Insulin signaling pathway;KEGG PATHWAY;hsa04910

Pathway

Class I PI3K signaling events mediated by Akt;PID Curated;200169

Pathway

Signaling events mediated by HDAC Class III;PID Curated;200020

Pathway

AKT-mediated inactivation of FOXO1A;PID Reactome;500523

Pathway

Regulation of Androgen receptor activity;PID Curated;200102

Pathway

Angiopoietin receptor Tie2-mediated signaling;PID Curated;200066

Pathway

Regulation of nuclear SMAD2/3 signaling;PID Curated;200002

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

CXCR4-mediated signaling events;PID Curated;200083

Pathway

IL6-mediated signaling events;PID Curated;200124

Pathway

FoxO family signaling;PID Curated;200091

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

Regulation of beta-cell development;Reactome;REACT:13698

Pathway

PI3 kinase pathway;PANTHER;P00048

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Regulation of gene expression in beta cells;PID Reactome;500522

Disease

Cancers;KEGG DISEASE

Disease

Rhabdomyosarcoma, alveolar;OMIM

Disease

Prostate cancer;FunDO

Disease

Muscular atrophy;FunDO

Disease

Cancers of soft tissues and bone;KEGG DISEASE

Disease

Leukemia;FunDO

Disease

Congenital abnormality;FunDO

Disease

Alveolar rhabdomyosarcoma;KEGG DISEASE;H00037

Disease

Central corneal thickness;NHGRI

External Links

Links to cell senescence gene database

2308

Links to epithelial mesenchymal transition gene database

2308

Links to ovarian cancer gene database

2308

Links to endometrial cancer gene database

2308

Links to iHOP

2308

Sequence Information

Nucleotide Sequence

>2308 : length: 5738
GCAGCCGCCACATTCAACAGGCAGCAGCGCAGCGGGCGCGCCGCTGGGGAGAGCAAGCGG
CCCGCGGCGTCCGTCCGTCCTTCCGTCCGCGGCCCTGTCAGCTGGAGCGCGGCGCAGGCT
CTGCCCCGGCCCGGCGGCTCTGGCCGGCCGTCCAGTCCGTGCGGCGGACCCCGAGGAGCC
TCGATGTGGATGGCCCCGCGAAGTTAAGTTCTGGGCTCGCGCTTCCACTCCGCCGCGCCT
TCCTCCCAGTTTCCGTCCGCTCGCCGCACCGGCTTCGTTCCCCCAAATCTCGGACCGTCC
CTTCGCGCCCCCTCCCCGTCCGCCCCCAGTGCTGCGTTCTCCCCCTCTTGGCTCTCCTGC
GGCTGGGGGAGGGGCGGGGGTCACCATGGCCGAGGCGCCTCAGGTGGTGGAGATCGACCC
GGACTTCGAGCCGCTGCCCCGGCCGCGCTCGTGCACCTGGCCGCTGCCCAGGCCGGAGTT
TAGCCAGTCCAACTCGGCCACCTCCAGCCCGGCGCCGTCGGGCAGCGCGGCTGCCAACCC
CGACGCCGCGGCGGGCCTGCCCTCGGCCTCGGCTGCCGCTGTCAGCGCCGACTTCATGAG
CAACCTGAGCTTGCTGGAGGAGAGCGAGGACTTCCCGCAGGCGCCCGGCTCCGTGGCGGC
GGCGGTGGCGGCGGCGGCCGCCGCGGCCGCCACCGGGGGGCTGTGCGGGGACTTCCAGGG
CCCGGAGGCGGGCTGCCTGCACCCAGCGCCACCGCAGCCCCCGCCGCCCGGGCCGCTGTC
GCAGCACCCGCCGGTGCCCCCCGCCGCCGCTGGGCCGCTCGCGGGGCAGCCGCGCAAGAG
CAGCTCGTCCCGCCGCAACGCGTGGGGCAACCTGTCCTACGCCGACCTCATCACCAAGGC
CATCGAGAGCTCGGCGGAGAAGCGGCTCACGCTGTCGCAGATCTACGAGTGGATGGTCAA
GAGCGTGCCCTACTTCAAGGATAAGGGTGACAGCAACAGCTCGGCGGGCTGGAAGAATTC
AATTCGTCATAATCTGTCCCTACACAGCAAGTTCATTCGTGTGCAGAATGAAGGAACTGG
AAAAAGTTCTTGGTGGATGCTCAATCCAGAGGGTGGCAAGAGCGGGAAATCTCCTAGGAG
AAGAGCTGCATCCATGGACAACAACAGTAAATTTGCTAAGAGCCGAAGCCGAGCTGCCAA
GAAGAAAGCATCTCTCCAGTCTGGCCAGGAGGGTGCTGGGGACAGCCCTGGATCACAGTT
TTCCAAATGGCCTGCAAGCCCTGGCTCTCACAGCAATGATGACTTTGATAACTGGAGTAC
ATTTCGCCCTCGAACTAGCTCAAATGCTAGTACTATTAGTGGGAGACTCTCACCCATTAT
GACCGAACAGGATGATCTTGGAGAAGGGGATGTGCATTCTATGGTGTACCCGCCATCTGC
CGCAAAGATGGCCTCTACTTTACCCAGTCTGTCTGAGATAAGCAATCCCGAAAACATGGA
AAATCTTTTGGATAATCTCAACCTTCTCTCATCACCAACATCATTAACTGTTTCGACCCA
GTCCTCACCTGGCACCATGATGCAGCAGACGCCGTGCTACTCGTTTGCGCCACCAAACAC
CAGTTTGAATTCACCCAGCCCAAACTACCAAAAATATACATATGGCCAATCCAGCATGAG
CCCTTTGCCCCAGATGCCTATACAAACACTTCAGGACAATAAGTCGAGTTATGGAGGTAT
GAGTCAGTATAACTGTGCGCCTGGACTCTTGAAGGAGTTGCTGACTTCTGACTCTCCTCC
CCATAATGACATTATGACACCAGTTGATCCTGGGGTAGCCCAGCCCAACAGCCGGGTTCT
GGGCCAGAACGTCATGATGGGCCCTAATTCGGTCATGTCAACCTATGGCAGCCAGGCATC
TCATAACAAAATGATGAATCCCAGCTCCCATACCCACCCTGGACATGCTCAGCAGACATC
TGCAGTTAACGGGCGTCCCCTGCCCCACACGGTAAGCACCATGCCCCACACCTCGGGTAT
GAACCGCCTGACCCAAGTGAAGACACCTGTACAAGTGCCTCTGCCCCACCCCATGCAGAT
GAGTGCCCTGGGGGGCTACTCCTCCGTGAGCAGCTGCAATGGCTATGGCAGAATGGGCCT
TCTCCACCAGGAGAAGCTCCCAAGTGACTTGGATGGCATGTTCATTGAGCGCTTAGACTG
TGACATGGAATCCATCATTCGGAATGACCTCATGGATGGAGATACATTGGATTTTAACTT
TGACAATGTGTTGCCCAACCAAAGCTTCCCACACAGTGTCAAGACAACGACACATAGCTG
GGTGTCAGGCTGAGGGTTAGTGAGCAGGTTACACTTAAAAGTACTTCAGATTGTCTGACA
GCAGGAACTGAGAGAAGCAGTCCAAAGATGTCTTTCACCAACTCCCTTTTAGTTTTCTTG
GTTAAAAAAAAAAACAAAAAAAAAAACCCTCCTTTTTTCCTTTCGTCAGACTTGGCAGCA
AAGACATTTTTCCTGTACAGGATGTTTGCCCAATGTGTGCAGGTTATGTGCTGCTGTAGA
TAAGGACTGTGCCATTGGAAATTTCATTACAATGAAGTGCCAAACTCACTACACCATATA
ATTGCAGAAAAGATTTTCAGATCCTGGTGTGCTTTCAAGTTTTGTATATAAGCAGTAGAT
ACAGATTGTATTTGTGTGTGTTTTTGGTTTTTCTAAATATCCAATTGGTCCAAGGAAAGT
TTATACTCTTTTTGTAATACTGTGATGGGCCTCATGTCTTGATAAGTTAAACTTTTGTTT
GTACTACCTGTTTTCTGCGGAACTGACGGATCACAAAGAACTGAATCTCCATTCTGCATC
TCCATTGAACAGCCTTGGACCTGTTCACGTTGCCACAGAATTCACATGAGAACCAAGTAG
CCTGTTATCAATCTGCTAAATTAATGGACTTGTTAAACTTTTGGAAAAAAAAAGATTAAA
TGCCAGCTTTGTACAGGTCTTTTCTATTTTTTTTTGTTTATTTTGTTATTTGCAAATTTG
TACAAACATTTAAATGGTTCTAATTTCCAGATAAATGATTTTTGATGTTATTGTTGGGAC
TTAAGAACATTTTTGGAATAGATATTGAACTGTAATAATGTTTTCTTAAAACTAGAGTCT
ACTTTGTTACATAGTCAGCTTGTAAATTTTGTGGAACCACAGGTATTTGGGGCAGCATTC
ATAATTTTCATTTTGTATTCTAACTGGATTAGTACTAATTTTATACATGCTTAACTGGTT
TGTACACTTTGGGATGCTACTTAGTGATGTTTCTGACTAATCTTAAATCATTGTAATTAG
TACTTGCATATTCAACGTTTCAGGCCCTGGTTGGGCAGGAAAGTGATGTATAGTTATGGA
CACTTTGCGTTTCTTATTTAGGATAACTTAATATGTTTTTATGTATGTATTTTAAAGAAA
TTTCATCTGCTTCTACTGAACTATGCGTACTGCATAGCATCAAGTCTTCTCTAGAGACCT
CTGTAGTCCTGGGAGGCCTCATAATGTTTGTAGATCAGAAAAGGGAGATCTGCATCTAAA
GCAATGGTCCTTTGTCAAACGAGGGATTTTGATCCACTTCACCATTTTGAGTTGAGCTTT
AGCAAAAGTTTCCCCTCATAATTCTTTGCTCTTGTTTCAGTCCAGGTGGAGGTTGGTTTT
GTAGTTCTGCCTTGAGGAATTATGTCAACACTCATACTTCATCTCATTCTCCCTTCTGCC
CTGCAGATTAGATTACTTAGCACACTGTGGAAGTTTAAGTGGAAGGAGGGAATTTAAAAA
TGGGACTTGAGTGGTTTGTAGAATTTGTGTTCATAAGTTCAGATGGGTAGCAAATGGAAT
AGAACTTACTTAAAAATTGGGGAGATTTATTTGAAAACCAGCTGTAAGTTGTGCATTGAG
ATTATGTTAAAAGCCTTGGCTTAAGAATTTGAAAATTTCTTTAGCCTGTAGCAACCTAAA
CTGTAATTCCTATCATTATGTTTTATTACTTTCCAATTACCTGTAACTGACAGACCAAAT
TAATTGGCTTTGTGTCCTATTTAGTCCATCAGTATTTTCAAGTCATGTGGAAAGCCCAAA
GTCATCACAATGAAGAGAACAGGTGCACAGCACTGTTCCTCTTGTGTTCTTGAGAAGGAT
CTAATTTTTCTGTATATAGCCCACATCACACTTGCTTTGTCTTGTATGTTAATTGCATCT
TCATTGGCTTGGTATTTCCTAAATGTTTAACAAGAACACAAGTGTTCCTGATAAGATTTC
CTACAGTAAGCCAGCTCTATTGTAAGCTTCCCACTGTGATGATCATTTTTTTGAAGATTC
ATTGAACAGCCACCACTCTATCATCCTCATTTTGGGGCAGTCCAAGACATAGCTGGTTTT
AGAAACCCAAGTTCCTCTAAGCACAGCCTCCCGGGTATGTAACTGAACTTGGTGCCAAAG
TACTTGTGTACTAATTTCTATTACTACGTACTGTCACTTTCCTCCCGTGCCATTACTGCA
TCATAATACAAGGAACCTCAGAGCCCCCATTTGTTCATTAAAGAGGCAACTACAGCCAAA
ATCACTGTTAAAATCTTACTACTTCATGGAGTAGCTCTTAGGAAAATATATCTTCCTCCT
GAGTCTGGGTAATTATACCTCTCCCAAGCCCCCATTGTGTGTTGAAATCCTGTCATGAAT
CCTTGGTAGCTCTCTGAGAACAGTGAAGTCCAGGGAAAGGCATCTGGTCTGTCTGGAAAG
CAAACATTATGTGGCCTCTGGTAGTTTTTTTCCTGTAAGAATACTGACTTTCTGGAGTAA
TGAGTATATATCAGTTATTGTACATGATTGCTTTGTGAAATGTGCAAATGATATCACCTA
TGCAGCCTTGTTTGATTTATTTTCTCTGGTTTGTACTGTTATTAAAAGCATATTGTATTA
TAGAGCTATTCAGATATTTTAAATATAAAGATGTATTGTTTCCGTAATATAGACGTATGG
AATATATTTAGGTAATAGATGTATTACTTGGAAAGTTCTGCTTTGACAAACTGACAAAGT
CTAAATGAGCACATGTATCCCAGTGAGCAGTAAATCAATGGAACATCCCAAGAAGAGGAT
AAGGATGCTTAAAATGGAAATCATTCTCCAACGATATACAAATTGGACTTGTTCAACTGC
TGGATATATGCTACCAATAACCCCAGCCCCAACTTAAAATTCTTACATTCAAGCTCCTAA
GAGTTCTTAATTTATAACTAATTTTAAAAGAGAAGTTTCTTTTCTGGTTTTAGTTTGGGA
ATAATCATTCATTAAAAAAAATGTATTGTGGTTTATGCGAACAGACCAACCTGGCATTAC
AGTTGGCCTCTCCTTGAGGTGGGCACAGCCTGGCAGTGTGGCCAGGGGTGGCCATGTAAG
TCCCATCAGGACGTAGTCATGCCTCCTGCATTTCGCTACCCGAGTTTAGTAACAGTGCAG
ATTCCACGTTCTTGTTCCGATACTCTGAGAAGTGCCTGATGTTGATGTACTTACAGACAC
AAGAACAATCTTTGCTATAATTGTATAAAGCCATAAATGTACATAAATTATGTTTAAATG
GCTTGGTGTCTTTCTTTTCTAATTATGCAGAATAAGCTCTTTATTAGGAATTTTTTGTGA
AGCTATTAAATACTTGAGTTAAGTCTTGTCAGCCACAA

Protein Sequence

>2308 : length: 655
MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPS
ASAAAVSADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHP
APPQPPPPGPLSQHPPVPPAAAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKR
LTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLN
PEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPG
SHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLP
SLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPN
YQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPV
DPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLP
HTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPS
DLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG